(data stored in ACNUC7421 zone)

EMBL: CP000675.PE777

CP000675.PE777       Location/Qualifiers
FT   CDS_pept        843663..844589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2611"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56526"
FT                   /protein_id="ABQ56526.1"
FT                   /translation="MSKWSSKQIIIDVSGLAKSFNGINAVVNLNLQIEEGTIFGFLGPN
FT                   GSGKTTSLRLLSGLIIPDKGQGRCLNLDLMTQTKLIQAQIGYMPQNFCLYQNLTVYENL
FT                   DFIARIYQLKNRKERLKEIIELLALSDNQKRITATLSGGWKQRVALAAALLHKPRILLL
FT                   DEPTSGIDPQSRLLIWAHIQSIVSKGVTVLLSTQHMDEAERCHQLVYMSAGEIIARGSV
FT                   IEIIQSTGLHSWVVKGESFSRLKDILVNNPAIQMIEKGNEMRISSIVDDIHQVLDPFVL
FT                   NNYEIKKTDTTLEDAFIYKIMKEGNPK"
     atgagtaaat ggagctcaaa gcaaattatt atcgatgtgt ccggattagc aaaatcattt        60
     aatggtatca acgcagtagt gaacttgaat ttgcaaatcg aggaaggaac aatttttggt       120
     tttttagggc caaacggtag tggtaaaacg accagtttac gattattaag tggattaata       180
     attcccgata aaggccaggg tagatgtctg aatctcgatt taatgaccca aaccaagttg       240
     atacaggctc aaattggcta tatgccacaa aatttttgcc tctatcaaaa tctgactgtt       300
     tatgaaaatc tggattttat cgcaagaata taccaattaa aaaacaggaa agagagactg       360
     aaggaaatca ttgaattact ggccttaagt gacaaccaaa aacggattac tgctacttta       420
     tcaggaggtt ggaagcagcg ggtggcttta gcggctgctt tgttgcataa gcctcgtata       480
     cttttgttag acgagccaac ttcaggcatt gatcctcaat cgcgtttgtt aatttgggct       540
     catatacaaa gtatagtatc caaaggagtt actgttttac tcagcacaca gcatatggat       600
     gaggcagaaa gatgtcatca attggtttat atgtccgccg gagaaatcat agcacgtggc       660
     tcagtgattg aaattattca atcgacaggt ttgcactcct gggttgttaa aggtgagagt       720
     ttctccagat taaaggacat attagtaaat aaccccgcta ttcaaatgat tgaaaagggt       780
     aatgaaatgc gcatcagctc aatagttgat gatatacatc aagtattgga tcctttcgtg       840
     ttgaacaatt atgaaatcaa aaaaacagat actactttag aagacgcttt catttataaa       900
     attatgaaag aagggaatcc aaagtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page