(data stored in ACNUC7421 zone)

EMBL: CP000675.PE780

CP000675.PE780       Location/Qualifiers
FT   CDS_pept        complement(847201..848961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2608"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56523"
FT                   /protein_id="ABQ56523.1"
FT                   /translation="MKKWLLFSLLFLTSLCVHAEPLPASEVFKVSVKKIDPNTFAIQWN
FT                   ILPKYFLYSDRIQLNSDNDDIAQLGTLRFPTPLTKTDKQGRTFKVYRNQLNLPVGVLGI
FT                   TPGETIVNLRFQGCADDGFCYPPEVKQIKLAIDDKLALSQVDLETFHAPEATPLEKPEQ
FT                   DIADIFANHNWIMILLIFYGFGLLLSFTPCILPMVPVLSGIIVGHGKTATTKKAFFLSL
FT                   SYVLSMSVTYAVVGAVVALLGANLQISMQSPWAISLFSLIFVLLALSMFGFYEFKLPDA
FT                   WQSKIVGSSREQRGGHYLGAAIMGCLSTLILSPCVTAPLIGVLTYIAQTGNVLLGSVTL
FT                   FTLSLGMGTPLLLIGTSAGKWLPETGSWMNAVKAFFGILLLAVAIYLMARILPAGLVMG
FT                   LWACLLIFSGIYSGALTKSNTNQEKLCQGIGIILLTYGLLILIGASMGSSNPLQPLANL
FT                   QAAPTVSNAFESAKAQSVKSVELAIKQAFGKPVMLDFYADWCASCKVMENTTFKDPRVQ
FT                   KALSHFIVIKVDVTANNKNDRALMQHFRVVAPPTFIFFNAEGVQLNNLKRVGELNADEF
FT                   MQTIKSIDEN"
     atgaaaaaat ggctcttatt ttccctatta tttttaactt ccctttgtgt tcatgctgag        60
     cccttgccag cttctgaagt attcaaggtt agtgtaaaaa aaatagaccc caataccttt       120
     gccatacaat ggaatatctt gcccaagtat tttttatata gcgaccgtat tcaattaaat       180
     tccgataatg atgacattgc acagcttgga actcttcgct tccccacccc cttaaccaaa       240
     acggataaac aagggcgaac ctttaaagtt tatcgcaatc agcttaacct tccagtggga       300
     gtcctgggca ttaccccagg agaaacaata gtcaatttgc gttttcaagg atgtgccgac       360
     gatggttttt gttatccccc cgaagtaaaa caaatcaaac tggcaattga cgataaactg       420
     gctctttctc aagttgattt ggaaacattc catgcacctg aagcaacacc tcttgaaaaa       480
     ccggaacaag acatcgctga tatttttgca aatcataatt ggataatgat tctgcttata       540
     ttttacggat ttggcctgct cctgtccttc acgccttgta tactgcctat ggtccctgtc       600
     ctttcaggta ttattgttgg ccatgggaaa acggcaacaa cgaaaaaagc gtttttcctg       660
     tcattaagct acgttcttag catgtctgtc acttatgctg ttgtgggtgc tgtcgttgcc       720
     ttgcttggag ccaatttaca aatcagtatg caatcacctt gggctatcag tctattcagt       780
     ctgatattcg ttttgctggc cttgtccatg tttggctttt atgaattcaa actgccagat       840
     gcatggcaaa gcaaaattgt aggttcaagt cgtgaacaac gtggtggaca ctatcttggg       900
     gcagccatca tgggatgttt gtccacactt attctgtcac catgtgttac agcaccatta       960
     attggagtat taacctacat agcacaaacc ggaaacgtat tactcggcag tgtcactcta      1020
     tttacattaa gcctcggcat gggtactcca ttactgctga taggaacttc tgctggtaaa      1080
     tggctacccg aaacaggaag ctggatgaat gctgttaaag ctttctttgg catattactt      1140
     cttgctgttg ccatctatct gatggcacgc attttaccag caggtttggt catggggcta      1200
     tgggcttgtc tcctgatctt ttccggcatt tactctggtg ccttaaccaa atcgaatacc      1260
     aaccaggaaa agctctgcca aggcattggt atcattttat taacctatgg attgctgatt      1320
     ctcattggag ctagcatggg ctcttccaac cctttgcagc ctttagccaa cttacaagca      1380
     gcccctactg taagcaatgc ttttgaatcg gctaaagccc aatctgttaa aagtgttgaa      1440
     ctggctataa aacaagcgtt cggaaaacca gtgatgcttg atttttatgc tgactggtgt      1500
     gcatcgtgta aagtgatgga aaacaccacg ttcaaagatc ctcgtgtaca aaaagctttg      1560
     agccatttta tcgttatcaa agtggatgtg actgccaata ataaaaatga cagagcatta      1620
     atgcagcatt tccgtgtagt agcccccccg acttttatct tttttaatgc tgagggcgta      1680
     caactcaata atttgaaaag agttggtgaa ttgaatgccg atgaattcat gcaaacaata      1740
     aaaagcattg atgagaacta a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page