(data stored in ACNUC7421 zone)

EMBL: CP000675.PE789

CP000675.PE789       Location/Qualifiers
FT   CDS_pept        864623..867460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56514"
FT                   /protein_id="ABQ56514.1"
FT                   /translation="MPNLPGLYFLQAYPREEIWRLFVDGRFWSKENGWRGYESREPGCL
FT                   NAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFG
FT                   IPAGRASIKGIEEFLSLVFLTEGEAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQI
FT                   YFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNQEIKTAETLDEKLKIIVKHIRMYE
FT                   VLHPFRDANGRTFVNNLLNILLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVE
FT                   IIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPAYEKIKHMDFSDLNPEKLHRKTQKCL
FT                   SSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISG
FT                   NMAMIDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKD
FT                   NHGKTAFHYAAEFGTPELISALTTTEVIQINEPDNSGSSAITLAYKNHKLKIFDELLNS
FT                   GADISDELLDAIWARKDKETLGKIIAKNEKILLNKEAFRIAISLGSVSLVKKFLRAGVD
FT                   IDIPLTKDKATPLMLSINSGNPKLVSYLLKKGANTRLTDTSGNSVLHYVFYSKAENREA
FT                   LANIITEKDKKLINQPNTNGNPPLYNAVVVNDLKMATILLEMGARVDFEDRLGNNILHS
FT                   AMRRCDLPIILDIVKKDSTLLHNRNSERRNPFHQALHEMHTFPSSKETEEIHFMNLSDL
FT                   LLKEGVDLNKKDIKGKTILDIALSKQYFHLCVKLMKAGAHTNISSPSKFLKNSDANSIL
FT                   ERPFKFKNDLKKELDDNPLIAMAQINDLYVQIKNNRIRTPTGYAPKEGVSFFKGKSSDA
FT                   KAHDEVLSVLKELYDSKLTEMLGNLPGEGLEEIKRSQKFFDGELKLLIKNQDISRKVDK
FT                   KSIQEAVGTSLKLKW"
     atgccaaatc tacctggatt atattttctt caagcctatc cacgcgaaga aatatggaga        60
     ttatttgttg atggacgctt ctggtcaaaa gaaaatggat ggagaggcta tgagtcgcga       120
     gagccaggat gccttaacgc cgctctggag agtttatgtt ctattgcatt gcaagttgag       180
     aaatcaggag aggaatttga attaagcgtt gatttaataa agaggataca caagaagtgt       240
     ggaaaaaagg tggaggaatt acaggaaaaa aatccaggtg aactcagaac agatgaacct       300
     gtttcatttg gcattccagc tggccgggcc tcgattaagg gtattgaaga attcctgagc       360
     ctggtatttc ttacagaagg cgaagctgaa tttggcccag gcaaagcagg tccatttggc       420
     ccacgctttg ataagaatta ttttaaaaat ctgaatccag aacaaatacc ggatcttgcc       480
     aagcaaatct atttcgatat gtgcaaatat gggcatagta ataccaatca cttttatctt       540
     gcagtaatga aaaatgtgga tgtttacctg gaaaaaatta cccaatctta caaccaggaa       600
     ataaaaaccg ctgaaactct tgatgaaaaa cttaaaatta tcgttaagca tattcgaatg       660
     tacgaagtat tgcacccttt tcgagatgcc aatggccgta cctttgtcaa taatttatta       720
     aatattcttt taatgcaaca aggtttaccg ccagcgacat tttacgaacc taatgtcttt       780
     gatttatata gcgctgagga attagttgtt gttgtgaagg aggcaatttt taatacggta       840
     gaaattattg aacaaagtaa aagaaagact cccattactt tatatggata tcattcaagc       900
     ttggaagagc aaaccaaatt tcgggacatg ctggatagcc cagcgtatga aaaaatcaaa       960
     catatggatt tttcagattt aaaccctgag aaactgcatc ggaagactca aaaatgttta      1020
     tcatcattaa atgagcaata tccattacac agaggtgcaa tctatcttag tgatcccggt      1080
     gagataaaat tattattgtc aaatcgcaat gaatcccaga ttaatcagca gatagagcaa      1140
     ggagcaccgc ctatttatgt cggtaaaact cctgctcatt tggctgtcat atcaggaaat      1200
     atggcaatga ttgatgagct tatcgcaaaa aaagcggatt tatctcttca ggattatgat      1260
     ggaaaaaccg ctcttcacta tgctgcagag tgtggaaata tgcaaattat gggaaaaata      1320
     ctaaaagttg tgctaagcca ggaagatgcc atcaaagtac tgaatatcaa ggataatcat      1380
     ggcaaaacag cattccatta tgctgctgag tttggaaccc cggaattaat atcagccttg      1440
     acaaccacag aggttattca gattaatgaa ccggataaca gcggttcttc agcaatcact      1500
     ttggcatata aaaatcataa attgaaaatt ttcgatgaac tattaaattc cggtgctgat      1560
     atcagtgatg agcttttgga cgcgatatgg gctcggaagg ataaagaaac attaggtaaa      1620
     ataattgcca aaaatgagaa aattcttttg aataaagaag ccttcaggat agctatttct      1680
     ttaggaagtg tcagtctggt taaaaaattt ttacgcgccg gggtcgatat tgatataccc      1740
     ttaactaaag ataaagcaac accgctaatg ttatctataa attccggtaa tcccaaattg      1800
     gtcagttatt tattgaaaaa gggagctaat acacgtttaa ccgataccag tggtaattct      1860
     gtcctgcatt atgtttttta ttcaaaggca gaaaacaggg aagctttagc aaatattata      1920
     actgagaaag ataagaaatt aattaatcag ccaaatacta atggaaatcc acctctttat      1980
     aatgctgtgg tagttaatga tttgaaaatg gcaacaattt tattagaaat gggggcaagg      2040
     gtcgatttcg aagacaggct gggaaataat attttgcata gtgccatgag aagatgtgat      2100
     ttgccgatta tattggatat tgtcaagaaa gatagcacct tacttcataa tagaaactct      2160
     gaaagaagaa atccttttca tcaggcattg catgagatgc atacgtttcc atcctcaaaa      2220
     gaaaccgaag aaatacactt catgaattta agtgatttac ttttaaaaga aggagtcgat      2280
     ttaaataaaa aagatattaa aggaaaaaca atattagata tcgcattatc caagcagtat      2340
     tttcatttat gtgtcaaact gatgaaagca ggtgcccata ccaatatatc ttctccatca      2400
     aaatttctta aaaactccga tgccaattct attttggaac gtccttttaa atttaagaac      2460
     gatttaaaaa aagagctcga tgataatccg ctaattgcta tggcacaaat taatgatttg      2520
     tacgtccaaa tcaaaaataa caggattagg actcctacag gttatgcccc gaaagaagga      2580
     gtatcctttt ttaaaggaaa atcaagcgat gccaaagcac atgatgaggt tttgtctgtt      2640
     ttaaaggaac tctacgatag taaactcaca gagatgctcg gtaatcttcc tggtgaagga      2700
     ttagaagaaa tcaaaagaag ccagaaattt tttgacggcg aactaaaatt attaattaaa      2760
     aaccaggaca tttcgaggaa agtcgataaa aagtctattc aggaagcagt tggtacatcc      2820
     ttgaaattaa aatggtaa                                                    2838
//

If you have problems or comments...

PBIL Back to PBIL home page