(data stored in ACNUC7421 zone)

EMBL: CP000675.PE79

CP000675.PE79        Location/Qualifiers
FT   CDS_pept        77278..78204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54079"
FT                   /protein_id="ABQ54079.1"
FT                   /translation="MNSLKNEYYIRAPKEKDFQNYNGKELKKIHLFMNKIYHQILFGDK
FT                   PIDNKVFHEFKKYESSWMANEKNYFLTKYDCNVIVKDESLVRDVLQKHEVFNHPIFDYL
FT                   MHDASIEDLKKFAYSESIMNLEFFDYLALAVIGVSDQAKVEIMANLWDEAGQGCAEKFH
FT                   TVLFQNFLNDLGITYDRKQILEGLSWEGVAGINLFNYFSIYPFNKTKYFGMLAATEMLD
FT                   PPHYNKLIKGIMRIFSSHNIDYSYYTEHELVDAHHASGWLNHVVIPELARKPYKTQDFW
FT                   LGFYMRLDSTKKYYDQLLNSLIMKKAA"
     atgaacagtt tgaaaaatga atattatata agagccccaa aagaaaaaga tttccaaaat        60
     tacaatggaa aagaattaaa gaaaatacat ctgtttatga ataaaattta tcatcaaata       120
     ttatttggtg ataaaccaat agataataaa gtattccatg agtttaaaaa atatgaatct       180
     tcatggatgg caaatgaaaa gaactatttt ttaacaaaat atgattgcaa tgtaattgta       240
     aaagatgaat ctcttgttag agacgtgttg caaaaacatg aggtatttaa tcatcctatc       300
     tttgattatt taatgcatga tgccagcatt gaggacctca aaaaattcgc ctatagcgaa       360
     tcaattatga atttggaatt ctttgactac ttagcattag cagtgatagg ggtatctgat       420
     caagcaaagg tagaaattat ggcaaacctt tgggatgagg caggccaagg atgtgctgag       480
     aaatttcata ccgtattgtt tcaaaatttt ttaaacgatt tgggtataac ctatgatcga       540
     aaacaaattt tagaaggcct gtcctgggaa ggagtggctg gaattaattt attcaattac       600
     ttttctatct atccttttaa taaaactaag tactttggca tgcttgcggc aacagagatg       660
     cttgaccctc cccattataa caaattaata aaaggcatta tgagaatatt tagttcgcat       720
     aatatcgatt actcctatta caccgaacac gaactagtgg acgctcacca tgcaagtggg       780
     tggcttaacc atgtcgtcat accagagcta gcacgtaagc cttataaaac gcaggatttt       840
     tggttgggtt tttacatgcg actggattcg accaaaaaat attatgacca attgttgaat       900
     agcttgatca tgaaaaaagc cgcgtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page