(data stored in ACNUC7421 zone)

EMBL: CP000675.PE797

CP000675.PE797       Location/Qualifiers
FT   CDS_pept        877180..878853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56506"
FT                   /protein_id="ABQ56506.1"
FT                   /translation="MAQYIFTMNRVSKIVENQRFILKDISLSFFPGAKIGVLGLNGSGK
FT                   STLLRIMAGVDTQYEGEARPQPGIKIGYLAQEPELDLSKTVREVVEEGVAEIKEKLSRF
FT                   DAISMRFAEPMSDDEMNALLMEQGELQNEIEACGGWDLERKLDVAADALRLPEWDAIIG
FT                   KLSGGERRRVALCRLLLSSPDMLLLDEPTNHLDAESVAWLEHYLEEFSGTVVAITHDRY
FT                   FLDNAAEWILELDRGEGIPYKGNYSSWLEQKEARLSMEKKQEDALQRAIKAELEWVRTS
FT                   PKGRHAKNKARLARFEEMNSKEFQKRNETNEIYIPPGERLGDLVLEGEKICKSYGDRIL
FT                   IDNFDFKLPKGGILGIIGPNGAGKSTFLKMLTGQEEPDKGVIRIGETVKLAYVDQMRDN
FT                   LNPNNSVWQEISDGHDIMQIGNFQMPSRAYVGRFNFKGTDQQKKISQLSGGERNRVHLA
FT                   KLLKSGGNVLLLDEPSNDLDVETLRALEEAILNFPGCAIVISHDRWFLDRICTHLMAFE
FT                   GDSQITFFEGNYTEYETDRKRRLGDEANRPSRIKYRKLSD"
     atggcgcagt atatattcac tatgaataga gtgagcaaga ttgttgagaa ccaaaggttt        60
     attttaaagg atatttcatt aagttttttt cccggggcaa aaattggcgt attaggatta       120
     aatggttctg gaaaatctac tctattgcgg attatggctg gtgttgatac acaatatgaa       180
     ggtgaagcaa gacctcagcc aggaattaaa attggatacc ttgctcaaga acctgagctt       240
     gacttaagta aaactgttcg tgaagtggtt gaggaaggtg tcgctgaaat taaagagaaa       300
     ctgtctcgtt tcgatgcgat tagtatgcgt tttgcagaac caatgagcga tgatgaaatg       360
     aatgccttgt taatggaaca aggtgagctg caaaatgaga tagaagcttg tggcggttgg       420
     gatctggaga gaaagctcga tgtggctgct gatgcgttaa gattacccga gtgggatgcc       480
     ataataggaa aactgtcggg tggtgaacgc agacgtgttg ctctttgtcg attgttgcta       540
     tcaagtcctg atatgttgct tcttgatgaa cctaccaacc atttggatgc agagagtgtt       600
     gcctggttag aacattatct tgaagagttt tctggtaccg ttgttgcaat tacccatgac       660
     aggtatttcc tggataatgc tgcggagtgg attttagaat tggatcgggg tgaaggcatc       720
     ccgtataagg ggaactacag ttcctggctt gaacaaaaag aagcacggtt gagtatggag       780
     aaaaagcaag aggatgcttt gcaacgtgct attaaagcag agttggaatg ggttagaacc       840
     tcacccaaag gacgtcatgc taaaaataag gcccgcttgg ctcggtttga agaaatgaat       900
     tctaaagaat tccaaaagcg taatgaaacc aatgaaatat atatcccgcc cggtgagcga       960
     ttaggtgatt tggttctgga aggtgaaaaa atatgcaaat cttatggtga caggatatta      1020
     atagacaatt ttgatttcaa acttcccaaa ggtggtattt taggaattat tggtcccaat      1080
     ggggcaggta agtctacttt tttaaaaatg ttaactgggc aggaagagcc agataagggc      1140
     gtcattcgta ttggagaaac agtgaagttg gcttatgttg atcagatgcg ggacaatcta      1200
     aaccccaaca attcggtgtg gcaagaaatt tcagatggcc atgacattat gcagataggt      1260
     aatttccaaa tgccttcacg agcctatgtt gggcgtttta attttaaagg gacggatcag      1320
     caaaagaaaa tttctcaatt gtctggcggg gagcgtaacc gggttcattt ggcaaaatta      1380
     ttgaaaagtg gcgggaatgt tttgctactc gatgaaccca gtaatgattt ggatgttgag      1440
     acattgagag ctttggaaga ggccatcctt aattttccag gttgtgctat agtgatttct      1500
     cacgatagat ggtttttaga tagaatttgc actcatttga tggcttttga aggtgattca      1560
     caaataacct ttttcgaagg taattacact gaatacgaaa cggatagaaa gcgtcgactg      1620
     ggtgatgaag ctaacagacc atcacgaatt aagtatcgaa aattaagcga ttaa            1674
//

If you have problems or comments...

PBIL Back to PBIL home page