(data stored in ACNUC7421 zone)

EMBL: CP000675.PE80

CP000675.PE80        Location/Qualifiers
FT   CDS_pept        78222..79031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54080"
FT                   /protein_id="ABQ54080.1"
FT                   /translation="MLVSNEKVIAEEWEKYAGYTVRPLPSTCAYYKDLIQSNSNKDSFL
FT                   IYGGTPEIRSLFQESNLKVTLTDQSELIVRAMGYLTMGAAPIAANEELVVTNWLNLEGI
FT                   ANDSCDFLIGDDAINMVEWTQFDLFLSNANRVLKSNGLFICHLLVKPQECFITNTIDDV
FT                   RREYKEGVIRTKYDLASRLNFICYDTNSYAMGWQNTIEQLGINQLDQFKPSFDFVGTFG
FT                   RCNSKFYCPPQDAFERLLTNYFHIEEVFYPHEYEYCQFEPVYVLRKK"
     atgcttgttt caaatgaaaa ggtaattgca gaagaatggg aaaaatatgc aggatacact        60
     gtgcggcctt tacctagtac ctgtgcctat tataaagatt taattcaatc taactctaat       120
     aaggactcat ttttaattta tggtggaaca ccagaaatca gatcactctt tcaggaatca       180
     aatttaaagg tcaccttaac ggatcaatct gagttaattg ttcgcgccat gggctatcta       240
     acaatgggtg cagcacctat tgctgccaat gaggaactcg ttgtaaccaa ttggcttaat       300
     ttagagggaa ttgctaatga ttcatgtgac ttcctcattg gtgatgatgc gattaatatg       360
     gttgagtgga ctcaatttga cttgttctta tctaatgcca atcgtgttct taaaagtaat       420
     ggcctattca tttgccattt attagtgaaa ccacaggaat gctttataac gaatacaata       480
     gatgatgtta ggcgtgagta taaagaggga gtgattagga ctaagtatga cttagccagt       540
     agattaaact ttatctgcta tgacactaat tcctatgcta tgggttggca aaatactatt       600
     gaacagctag gaatcaatca gttggatcag ttcaagccaa gttttgattt tgtaggtaca       660
     tttggacgat gtaatagcaa gttttattgt cctccccaag atgcatttga gcggttactc       720
     actaactatt tccatattga ggaagtattt tatccacatg agtatgagta ttgtcagttt       780
     gaaccagttt atgtattgcg taaaaaatag                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page