(data stored in ACNUC7421 zone)

EMBL: CP000675.PE802

CP000675.PE802       Location/Qualifiers
FT   CDS_pept        complement(881747..882721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2586"
FT                   /product="IcmL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56501"
FT                   /protein_id="ABQ56501.1"
FT                   /translation="MKKTVLWGALFTLITTQANSEATQQAISTQNSASTGTNVVSESTN
FT                   QVPATNQNTQQNQLNQPVQSNGQQPTQTIQNNQQNQPSQTGEQQSNQNTQNNQQNQPAQ
FT                   QQTTQQPAQQQVPSQQTAPVINCDYKISAETKAIEQSLVLTWSEKAIIQSFDFDPATVD
FT                   AQLQKLQACFTDQGWLSFNSALQKSGNLDAIKSQKLHVSSQIDGQPQVTEAIENQWKII
FT                   IPLQVVYQNDKEKVTQLLNVNVTVGRKITGDLGINQMIAVPRTATNTSQTNSPSNTNPA
FT                   DSNTSTSQTPGDTTNNATQTNTQTQTGTPTNSPPSGSTTNTQN"
     atgaagaaaa ctgtgctgtg gggtgcttta tttactctaa tcactactca agcgaactct        60
     gaagcaactc agcaagcgat atcaactcaa aattcggcgt ccaccggcac taatgtagtt       120
     tctgagtcaa cgaatcaggt acctgccacg aatcaaaaca cgcagcaaaa tcagctgaac       180
     caacctgtac aatcaaatgg acaacaacca actcaaacca ttcaaaacaa tcaacaaaat       240
     caaccgagcc agacagggga acaacagtct aaccaaaaca cccagaataa tcagcagaat       300
     caaccagcac agcaacaaac cacacagcag cctgctcaac aacaagtacc ttcacaacaa       360
     acagcgccag ttattaattg tgattacaag atttccgccg aaacaaaagc tatagagcaa       420
     tccttggttt taacctggtc agagaaagca ataattcagt catttgattt tgatccggct       480
     acggtagatg cccaattgca aaaattacaa gcctgcttta cagatcaagg atggctaagc       540
     tttaattcag cattgcaaaa atcaggtaat ctagatgcca ttaaatcaca aaagttgcat       600
     gttagcagcc aaattgatgg tcagccacaa gtgactgaag cgatagaaaa tcaatggaaa       660
     attatcatac cattacaagt tgtctatcaa aatgacaagg agaaggtaac ccaactactt       720
     aatgtcaacg taactgttgg gcgaaaaatt accggtgatt taggcatcaa ccaaatgatt       780
     gctgtacccc gcacagcaac caatacctca caaaccaatt caccgtctaa tacaaaccca       840
     gcagactcaa atacatcgac ctctcaaaca cctggtgaca caacaaataa tgctacccaa       900
     accaatacac aaacacagac tgggacacca accaactcac ctccgagtgg ctctacaaca       960
     aatacccaga attaa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page