(data stored in ACNUC7421 zone)

EMBL: CP000675.PE811

CP000675.PE811       Location/Qualifiers
FT   CDS_pept        890765..891760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56492"
FT                   /protein_id="ABQ56492.1"
FT                   /translation="MSKNESGTAKPIIKSTLMFFNSKLTDLNDKRLQLNRGKGLAKYLA
FT                   KSQKNTRDLAPLDAALGVMSFSLYMLRFSANVGLLAHLILVESQEKTNHKIRRDIYYSL
FT                   LNDSLWCVVNLTQFFWLSYRNSISAGLQGMQLETLAQLIDILVMIIRYQQDKKEYDLKY
FT                   NQAMGMERSRLAIEWQNKELNGLRSLLTSLSVVIAFGLFSFSAVAVPLSPVISSIILIS
FT                   SLLRVLIDIEKDRQLIHQLKLNETSREQIKNEQLAMTNARMKDLNKIILNSVFLPIGFF
FT                   LLITTPIPLTIIACVSMLLVHWLITNLINMRYSPNISVSPTIQTAELSLC"
     atgagcaaaa acgagtcagg cacagcaaaa ccgatcataa aatccacatt aatgtttttt        60
     aatagcaaac tgactgattt aaatgacaaa agacttcaat taaatcgtgg taaaggttta       120
     gcaaagtatt tagcaaaatc acaaaaaaac acaagggatc ttgctccctt agatgcggct       180
     ttgggtgtga tgagcttttc tctgtatatg cttcgatttt cagctaacgt tggtttatta       240
     gcgcatctca ttttagtcga atcgcaagaa aaaactaatc ataaaatacg aagggatatt       300
     tactacagtc ttttaaatga tagcttgtgg tgcgttgtta acctgaccca gtttttttgg       360
     ttatcttata gaaactcaat atctgcaggc cttcaaggga tgcaattaga aacgttggct       420
     caactcatcg atattttagt gatgattatt cgttaccaac aagacaaaaa ggaatatgac       480
     ttaaaataca atcaggctat gggtatggag cgctctcgtt tagcaattga atggcagaat       540
     aaagaattaa atggtcttcg atccttgctc acaagcttat ctgtagtgat agcttttgga       600
     ttattttcat tttcagcagt ggcagtacca ctttcgcctg taatatcttc tatcattctt       660
     attagttcac ttttacgagt tttaatcgat atagagaaag ataggcaatt aatacatcag       720
     cttaagctta atgagactag tcgagaacaa atcaagaatg aacaattggc aatgacgaac       780
     gctcgtatga aagatttaaa taaaataatt cttaatagcg tttttttacc tattggtttt       840
     tttctgttga tcacaactcc aatcccttta actataatag cctgtgtaag tatgttattg       900
     gttcactggt taattactaa tttaattaat atgaggtatt caccaaatat ctccgtatcc       960
     cccactattc aaactgctga attatctctc tgctga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page