(data stored in ACNUC7421 zone)

EMBL: CP000675.PE812

CP000675.PE812       Location/Qualifiers
FT   CDS_pept        891775..891867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56491"
FT                   /protein_id="ABQ56491.1"
FT                   /translation="MLAKNFKGVALTQNQVSYLILFYEIHWSAY"
     atgcttgcta aaaattttaa aggcgtggct ttgacccaaa atcaagtatc ctatctcatt        60
     ttattctatg aaattcattg gtctgcttat tga                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page