(data stored in ACNUC7421 zone)

EMBL: CP000675.PE814

CP000675.PE814       Location/Qualifiers
FT   CDS_pept        complement(892411..893658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2574"
FT                   /product="proton/sodium-glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56489"
FT                   /protein_id="ABQ56489.1"
FT                   /translation="MVTQFNTLKSYIFPIILLLSILLGGLTGYVFNQNVAWLKPFGDIF
FT                   LNLIFTTIVPLIFFSVSSAIARTGSIGKLGKIFYSMTVIFLFTGIVAAVYALFVVLLFP
FT                   PAQNMPVLLESSKQLSPTNLPDRLIEIFTVPEFSKLFSHEHILALVLFSILVGLAVAHS
FT                   KDKGTIFNSFLKAGEDVFMSVFRLIMYYAPIGFFAYFAVIVSEIGPQLMENYLRIAILY
FT                   YTASVFYFFFALTAYAYLAGKSQGVRLFWGNIFLPAATSIATCSSAASIPANLMATKSM
FT                   RIPAEIYETSIPLGSIIHKDGSVMGGVFKIAFLFGIFHLPFTSLPVLMMALGVSLLVGT
FT                   VMGAIPSGGMLGELLILSVYGFPPSVLIAVAAISIIIDPIATMVNVTSNSVCSMMIARL
FT                   VEGKNWFLRSSDENNL"
     gtggtaactc aattcaatac gcttaaatcc tatattttcc ccatcatttt gctattatct        60
     attttacttg gtgggttaac aggatatgtt tttaatcaaa acgttgcctg gttaaaaccc       120
     tttggcgata tttttcttaa tttgattttt actaccatcg ttcccctaat ttttttcagt       180
     gtatcctcag cgattgcaag aactggttct attggcaaat taggcaaaat attctactca       240
     atgacagtca tattcttatt tacaggaata gttgctgcag tttatgctct ttttgtagtt       300
     ttacttttcc ctccagcgca aaacatgcct gttctcttgg aaagttcaaa gcaactctct       360
     ccgacaaatc tcccggatcg cttgatagag atttttactg tacctgagtt ttcaaaatta       420
     ttctctcatg agcatattct ggcattagtt cttttttcaa ttctggtagg attggctgta       480
     gcccattcca aagataaagg tacaattttt aattccttct taaaagcagg agaagacgta       540
     ttcatgtcag tatttcgcct gattatgtat tatgctccta tcggtttttt tgcttatttt       600
     gcagtaatag taagcgaaat tggcccccaa ttaatggaaa attatttacg cattgccata       660
     ctctactata ccgcttcagt gttctacttt ttcttcgcct taactgccta tgcttatttg       720
     gcgggaaaat cccagggtgt ccggctattc tggggaaata ttttccttcc tgcagcgacc       780
     tccatagcaa cttgtagtag tgccgccagt attcctgcca acttaatggc aaccaaatcc       840
     atgcgcatcc ctgctgaaat ctatgaaaca tcaataccct taggctccat aattcataaa       900
     gatggatcag tcatgggcgg tgtttttaaa attgcctttt tattcgggat ctttcattta       960
     ccttttacca gcttgcccgt tcttatgatg gcattggggg tttctttgtt ggtaggaaca      1020
     gtaatgggag cgattcctag tggcgggatg ttaggagaat tgttaatttt gtcagtgtat      1080
     ggttttccac cttctgtttt aattgcagtt gctgctatta gcatcatcat tgatcccata      1140
     gcgacaatgg tcaacgtaac aagcaatagt gtttgcagca tgatgattgc acgtctggtc      1200
     gaaggtaaaa attggtttct cagatcctcc gatgaaaata acctataa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page