(data stored in ACNUC7421 zone)

EMBL: CP000675.PE816

CP000675.PE816       Location/Qualifiers
FT   CDS_pept        complement(896801..899707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2572"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56487"
FT                   /protein_id="ABQ56487.1"
FT                   /translation="MTGYPGADAELIAGFITTPLESAVASAEGIDYMTSSSQQGLSTIT
FT                   LNIKLNFDPQIAFTDVMSKVQQTLNQLPKESQQPVILKKSDSSTALMYISLDSKDMTPQ
FT                   QITDYATRVVQPQLQTVDGVAKADILGGQTYSMRIFMDPIKMAALNVTPADVSSVLASN
FT                   NFLTAAGSTKSEYVAINVTAKTDLNNVGEFERLIVKSDKGSIIRLRDIAKVELGSQNYD
FT                   SSVTFNSKKAVFISITPTPTANPLTVINDARKLFPSIVREFPPSLTGTIVYDATAFIRA
FT                   SIHEVMETIIEAAVIVIIVIFLFLGSVRSVLIPVVTIPLSLVGVCTLMLILGYSINLLT
FT                   LLAFVLAIGLVVDDAIVVVENVHRHLEEGKTPFESAIIGAREIATPVIAMTITLAAVYA
FT                   PIGFMSGLTGALFKEFAFTLASAVIISGVIALTLSPMMCSKILSEEATSGKFAIFLDEF
FT                   FNKLKRVYQNALHSILDTREIMLLLAGVVILMLPYLYSNTAAETAPDEDQGFFFVLATA
FT                   PQYATLNYIEAFTKPFDAIYKSFPETENYFTVNTSQPISGMVLKPWDQRKKSQFALKQP
FT                   LQNKLSKIAGLNALAIVPPPLPGGGGGPAVQFVVKTTNDFQSLMDVSNQLTEKARNSGL
FT                   FIYIDNSLKFNQPQVEFSINRAKASEMGLDMRALGSTLTSALSNNYINYFNLEGRSYQV
FT                   IPQLARKFRLTIEQIGQIYVKTLNGTMVPLSTVITPTEKTQPNAATHFQQLNSATIQAV
FT                   MMPGKTLGQGLEFLQKAAQEVLPKGFTYDYGGQSRQFMQEGSALIFAFLFAIIVIFLVL
FT                   AAQYESFRDPLIVLISVPMSICGALIPLNLGAATINIYTQVGLITLIGLISKHGILIVD
FT                   FANHLQREKNLDKRAAVEEAAGIRLRPILMTTAAMVFGVIPLLIASGAGAASRFDIGLV
FT                   ISTGLLIGTCFTLFVVPTLYTYLAEDHRHKPNEPAEIQ"
     atgactggtt accctggcgc tgatgctgaa ctcatagccg gatttatcac tactcctctt        60
     gaaagtgctg ttgccagtgc tgaaggaata gattatatga cttcatccag tcagcaaggc       120
     cttagcacaa ttaccttaaa catcaagttg aatttcgacc ctcaaattgc ttttactgat       180
     gtcatgagta aagtgcagca aacgctcaat cagttaccta aagagtcaca acaaccggtg       240
     atattgaaaa aatcagactc atcaaccgca ttgatgtaca ttagtctgga cagtaaggat       300
     atgactcctc agcaaattac tgactacgct acccgagtcg ttcaacccca gttgcaaaca       360
     gtggatggag tagccaaggc tgatatttta ggtggtcaaa cttattccat gcgaatattc       420
     atggatccaa ttaaaatggc tgcgcttaac gtcactcctg ctgatgtgtc ctctgtttta       480
     gccagtaaca atttcttgac tgcggctgga agtactaaaa gtgaatacgt agccatcaat       540
     gtcacggcta aaactgattt gaacaatgtc ggcgaatttg aaagactgat tgtaaaaagc       600
     gataaggggt caataatcag gctcagggat atcgctaaag tggaactggg ttcacaaaat       660
     tatgatagct cagtgacttt caacagtaaa aaggccgtct ttatatcgat cactccaaca       720
     ccaacggcta accctctcac agtaatcaat gatgctagaa aattgtttcc ttcgatagtc       780
     agagaattcc cgccgtcatt aactggcaca atagtatacg atgcaacagc attcattcgg       840
     gcatctatcc atgaggtaat ggaaactatc attgaagccg cagtcatcgt gatcatcgtt       900
     atctttttat ttttaggctc tgttcgttca gttcttattc ccgttgtcac cattccgctg       960
     tcattggttg gtgtctgtac tttgatgctc atactcggtt acagcatcaa cttgcttacc      1020
     cttcttgcct ttgtgttagc aataggattg gtagtggatg atgctattgt agtggtagaa      1080
     aacgtacatc gccatttgga agaaggaaaa actccctttg aatccgcaat tataggcgcc      1140
     agagaaattg ctaccccggt tattgcgatg acaatcaccc tggcagctgt ttatgcacca      1200
     atagggttta tgagtggact gactggcgct ttgttcaagg aatttgcttt tacgctggca      1260
     agtgcggtta ttatttcagg ggttattgcc ttaacgctgt cccccatgat gtgttcaaaa      1320
     attctatccg aagaagccac tagtggaaaa tttgctattt ttctggatga gttttttaac      1380
     aaactgaaac gcgtttacca gaatgcactt catagcatat tggatactcg agaaataatg      1440
     ttgctattag ccggggtcgt gattttaatg ttgccctatt tgtattcgaa cacagccgct      1500
     gaaaccgccc cggatgaaga tcaaggcttc ttttttgtac tggctactgc accacaatac      1560
     gctaccctaa actatatcga agcctttaca aaaccttttg atgccattta taaaagtttt      1620
     cctgaaaccg aaaactattt tactgtaaac acgagccaac ctatttcagg aatggttttg      1680
     aaaccatggg atcaaaggaa aaaaagtcag tttgctctaa aacaaccttt acaaaacaag      1740
     ttatctaaaa ttgcaggact taatgcttta gccattgttc cacctcccct gcctggcggt      1800
     ggtggtggac ctgccgttca gtttgtggtt aagacaacga atgatttcca gagtttaatg      1860
     gatgtgtcga accagctaac tgaaaaagcc cggaacagtg ggctatttat ttacatagac      1920
     aattctctta aatttaacca accacaagtg gaatttagca tcaatcgagc aaaagcttct      1980
     gaaatgggct tggatatgag agcgcttgga agcaccctga caagtgctct atctaacaac      2040
     tacatcaatt attttaatct ggaaggccga agctaccagg tcatcccaca actggctcgc      2100
     aaattccgtc ttactattga acagataggc caaatttatg taaaaacact taacggaacg      2160
     atggttccat tatctactgt gataacccca accgaaaaaa cgcaacctaa tgcagcgact      2220
     catttccaac aactcaattc agcaacaatt caggcggtca tgatgccagg caagacattg      2280
     ggtcaaggat tggagttttt acaaaaagca gcccaggaag tcttgcccaa aggatttaca      2340
     tatgattatg gaggacagtc caggcaattt atgcaagaag gaagtgcgct gatatttgca      2400
     ttcctttttg ctattattgt tatcttttta gtgctggcag cgcagtatga aagttttagg      2460
     gatccattaa tcgttctcat cagcgtgcca atgtctatct gtggtgcgct tatcccgctc      2520
     aacttgggag cagccacaat taatatctac actcaagtgg gtttgattac tttgattgga      2580
     ctcatcagta aacatggaat attgatagta gatttcgcta atcatttgca acgtgaaaaa      2640
     aatcttgata aacgtgctgc cgttgaggaa gctgctggaa ttagattacg acccatatta      2700
     atgactacag ctgccatggt gtttggagta atacctcttc ttattgccag tggtgctgga      2760
     gcagcgagtc gattcgacat agggctcgtt atctccacag ggttattaat aggtacctgt      2820
     ttcacactgt tcgtagtacc tactttatat acctacttag ctgaagatca tcgacataag      2880
     ccaaacgaac cagcagagat ccagtaa                                          2907
//

If you have problems or comments...

PBIL Back to PBIL home page