(data stored in ACNUC7421 zone)

EMBL: CP000675.PE818

CP000675.PE818       Location/Qualifiers
FT   CDS_pept        901468..901872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56485"
FT                   /protein_id="ABQ56485.1"
FT                   /translation="MKLKSLLFVVCFSLFSNVFAANLHLHPKADNADKKSIQKSVTYPG
FT                   YCQIEIINQSFTDVRVFGTFDDGTTIDFNIYRYESPHYISLFYNFYCHSGMYITITSPY
FT                   YTIYSGWTNVNSTIRVVPYLKEAKAELSTR"
     atgaagttaa aatcattgtt atttgttgta tgtttcagtt tattttctaa cgtttttgct        60
     gcaaatcttc acttacatcc caaggctgat aatgcagaca agaaatcaat acaaaagagc       120
     gtaacttatc ctggttactg ccaaattgaa atcattaacc aaagcttcac agatgttcgt       180
     gtattcggta cgtttgatga tggcacaact atagatttta atatctatcg ttatgagtca       240
     cctcactaca taagcctatt ctataatttc tattgccata gtggtatgta cattactatt       300
     acatcacctt actatactat ttattccggt tggacaaatg tgaacagtac catccgtgta       360
     gttccttact tgaaagaagc taaggctgag ttatcaacca gataa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page