(data stored in ACNUC7421 zone)

EMBL: CP000675.PE83

CP000675.PE83        Location/Qualifiers
FT   CDS_pept        80947..81894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0083"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54083"
FT                   /protein_id="ABQ54083.1"
FT                   /translation="MANLFSFLFLGTLGWGISLYLMKILLVSLTPTEIVLYRMAIGAAS
FT                   LFILAKLFKLKTDNIRGLILDGIIVGTFNMTLPFYLTTYAVKTVSSSLASVINGLTPLC
FT                   TLILGMVFFSSKQKLSVLNLLSIVLGFIGIIIINSDVSIYQGSAVEFIALLATTISYGV
FT                   TANYFKYHARTKDPILVSAVSAFVSAITMLIFKCATESSINYWGIPQDMHQIIALLWLG
FT                   VIGSGFCLYLYCSLIQNAGAVFASMITYLMTITGVIMGMIFLHETISHQVMIGCIFIFF
FT                   SLILVNHAPLLEKILVSISRQISLKSARRYELNQ"
     atggcaaatt tatttagttt tttgtttctt ggaacactgg gctggggcat ttcactctat        60
     ttaatgaaaa tattattggt gtctttaacg ccaacggaaa ttgttttgta tcgaatggca       120
     attggggcag cttctctctt tatcttggct aaactattta aattaaaaac ggataatatt       180
     cgtgggttaa ttctggatgg aataatagtt gggacattta acatgacgct gcctttttat       240
     ctgacaacct atgcagtaaa aactgtatcc agttcattag catccgttat taatgggctt       300
     acaccgctgt gcaccttaat attgggtatg gtgttttttt cttcaaaaca aaaattaagt       360
     gtattgaatc tattgagtat cgtgcttgga tttatcggaa taattattat taattcagat       420
     gtgagtattt atcaaggttc agctgttgaa ttcatagctc ttctagcaac aaccatttca       480
     tacggagtta ctgctaatta tttcaaatat catgctcgta ctaaagatcc aatacttgta       540
     tcagcagttt cggcattcgt ttctgcaatt acaatgctta ttttcaaatg tgcaacggaa       600
     tcctcaatta actactgggg aatacctcaa gacatgcatc agataatcgc tttgttatgg       660
     ttaggagtta ttggatcagg attttgttta tatctctact gttcgttaat ccaaaatgca       720
     ggtgcagttt ttgcgtcaat gattacctac cttatgacaa taacaggggt tatcatgggg       780
     atgatatttt tgcacgaaac aatttctcat caggtcatga ttggttgtat attcattttt       840
     ttctccttga tattagtaaa ccacgcgcct ttgcttgaaa agatattggt ttctatatca       900
     aggcaaattt cattaaaaag tgctcgtaga tatgaactaa atcagtag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page