(data stored in ACNUC7421 zone)

EMBL: CP000675.PE86

CP000675.PE86        Location/Qualifiers
FT   CDS_pept        83909..84232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54086"
FT                   /protein_id="ABQ54086.1"
FT                   /translation="MSWIVEFYNESVEEAILTMPPKIQARMIKLLELIETHGANLGPPH
FT                   TEAMGDGLFEIRAKAQEGIGRSLYCYMKGKHIVVLHAFVKKSAKTPKPDLQLALKRKRE
FT                   VEK"
     atgtcttgga ttgttgaatt ttataatgag tctgttgaag aggccatact tacaatgccg        60
     ccaaaaattc aggctcgaat gattaaactt ttggaattga ttgaaacaca tggcgctaat       120
     cttgggcctc ctcatacaga agcgatgggt gatgggttat ttgagattcg cgcaaaagct       180
     caagaaggaa tcgggcgatc gctttattgc tatatgaagg gaaagcatat tgtggttttg       240
     catgcatttg taaagaaaag tgcaaaaact ccaaaaccag atttgcaatt agctctcaaa       300
     agaaagcggg aggtagaaaa atga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page