(data stored in ACNUC7421 zone)

EMBL: CP000675.PE9

CP000675.PE9         Location/Qualifiers
FT   CDS_pept        complement(11607..12866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54009"
FT                   /protein_id="ABQ54009.1"
FT                   /translation="MTFTCDELKGLEHPYKVLGNGDALAENREELNKLTNDEKLVLASR
FT                   LVLECPVNELKDFAHAIEAARMPQDDSDTFHSFLFQAYQVKKRIISLLDPRNKNPHSMI
FT                   LEKEFDGELFNNFNKLAIDVLTNNEVAIALRLAETTPAQDRSRVSQNINNIFPQSLFAA
FT                   KVGHAFAVRRDIERLLLGDRPDQFFSSREFKIDSCIEFASLFNVINDKESSIAGKLALR
FT                   TPAENRSDVVMKIKGFCAEDSELAIKVQSAFALRRDIERNLLGDNPEQFFNSRDFSVDL
FT                   CLEFAILFPELLKGHEQAIGEKLAKLDAKVRSDISRKLEMINGAAHEQSSPFRIIASAM
FT                   VPKEEPCLTKPTPVVLPSTEEIIPKQESPTSLRNRNVLFKEQTEEHKKKNSQMEPIASD
FT                   SEEEEEKQNCWTSFCGLFGK"
     atgacgttta cttgcgatga attaaaagga ttagagcacc cttacaaagt acttggcaat        60
     ggtgacgcac tggcggaaaa ccgcgaagag ctaaacaaat taaccaatga tgaaaaatta       120
     gttttagcca gccgcctcgt tttggagtgc cccgttaatg aattaaaaga ttttgctcat       180
     gccattgaag cagcaagaat gccacaagat gatagcgata cctttcattc ctttttattc       240
     caggcttatc aggtaaaaaa aagaatcatt tccttgctcg atccgcgcaa taaaaaccct       300
     cattccatga tattggagaa ggaatttgat ggtgagctat ttaataattt taataaattg       360
     gctattgatg tattaactaa caatgaagtc gcaattgcat tgagactggc tgaaacaact       420
     cctgctcaag atcgttcccg agtatctcaa aatatcaaca atattttccc acagtctctg       480
     tttgccgcta aagtcggcca cgctttcgcc gttcgcagag acatagagcg actattgcta       540
     ggtgacaggc ctgatcaatt cttctcaagc cgtgaattca agatcgattc ttgtatcgag       600
     tttgcaagtt tattcaatgt aattaatgat aaagaatctt ccattgccgg aaaacttgcg       660
     ctgagaaccc ctgctgaaaa ccgctctgat gtagtaatga aaattaaagg tttttgtgcc       720
     gaggatagtg agcttgcgat aaaagtccaa tctgcttttg cattaagaag ggatatagag       780
     cgcaatctat tgggtgataa tccagaacaa tttttcaata gccgagattt tagcgttgat       840
     ttatgtcttg agtttgcaat tttattcccg gaattattaa aaggtcatga acaagctatc       900
     ggagaaaaat tagctaagct ggatgctaaa gtacgctcag atatcagtag aaaactggaa       960
     atgatcaatg gagcagctca cgagcaatca agtcctttca gaataatagc cagtgccatg      1020
     gtgcctaaag aagagccttg cctgacaaag cccactcccg ttgtcttgcc atctactgaa      1080
     gaaattatac caaagcaaga atcaccaacc agtttacgca acaggaacgt tttatttaaa      1140
     gaacaaacag aagagcacaa gaagaaaaac tctcagatgg aacccattgc ctcagattct      1200
     gaagaagaag aagagaaaca gaattgctgg actagttttt gtggattatt cggcaagtaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page