(data stored in ACNUC7421 zone)

EMBL: CP000675.PE90

CP000675.PE90        Location/Qualifiers
FT   CDS_pept        complement(86285..87697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54090"
FT                   /protein_id="ABQ54090.1"
FT                   /translation="MKSKKILILGLSITLTAITSASYAKKIFPSDIIGRDLNYPGMGWL
FT                   GHVGIATRPMMDSSGMSTPANQVIEILNEPVIGQINTIDNFKRRSPYWGSKYGVIGNPE
FT                   QGYRVLVEANHQRWWVREYTSNTDYRIAQGNPRTGEIFVTGRWRCDTYAWWAFYSQGVD
FT                   TMPGRIWLPRNLFNFFPYYNDERLVAESSEPSAEILTNKSLDDVSAEDLNEMSLEEFQT
FT                   VIDAPLKAPTNYVAPMSAYMRFAYSDSLNDIKRGAMIDKITSKVSDVDLVPKLLRLYDE
FT                   TDREEVKNKIVSGLMFHVQGELREHPNSRDKELLRSFFHRLIGEKLNQRCADWATMGFI
FT                   DTHTADETLQNLDKIDAQLATATHPASITLKYKLVHKSKKLQSIYIKSIVDELREANNS
FT                   DLDSYFFGPLAIGYQGTGKNLLEPESKQIVINYLDEVRYKYTSKGIKANPSDFHRGTTA
FT                   PYYFELLKHMDN"
     atgaaaagta aaaaaatact catattaggg ttaagcatta cactaaccgc tataacttca        60
     gcatcatatg ccaagaaaat ttttccttct gatatcatag gtagagattt aaattatccc       120
     ggcatgggat ggttaggaca tgttggcatt gctacaaggc caatgatgga ttcaagtggc       180
     atgtcaacgc ctgctaatca agtgatagag atacttaatg aaccagtaat aggtcagatt       240
     aatactatag ataattttaa aaggcgttcc ccctattggg gtagtaaata tggagtaatt       300
     ggtaaccctg agcagggcta tcgagtattg gttgaagcta atcaccagcg ttggtgggtt       360
     agagaatata ccagcaatac tgattatagg attgcgcaag ggaatccaag gacaggagaa       420
     atatttgtaa caggtcgttg gcgatgtgac acttatgctt ggtgggcttt ttacagccaa       480
     ggagtagaca ccatgcctgg tcgcatatgg ctaccacgga atttgtttaa tttttttcct       540
     tattataatg atgagaggtt ggttgcagaa tcctccgaac catcagcaga aattttaaca       600
     aataaatcct tagacgatgt aagcgctgaa gatcttaatg aaatgtcctt agaagagttt       660
     cagacagtaa tcgacgcccc cttaaaggct ccaactaatt atgttgctcc tatgtcagct       720
     tatatgcgtt ttgcttatag cgatagtctt aatgatatta aacgaggggc tatgattgat       780
     aaaattacat caaaggttag tgacgtagat ttagttccaa aattattaag attatatgat       840
     gaaacagacc gagaggaggt aaaaaataaa atagtaagcg gccttatgtt tcatgttcaa       900
     ggagagttaa gagaacaccc aaactccaga gataaagaat tattgagaag tttttttcat       960
     aggctaatag gcgaaaagct caatcaacga tgcgccgatt gggccacgat gggatttatt      1020
     gacacacata cggcagatga aaccctacaa aatctggata agatagatgc tcaattagca      1080
     actgcaaccc atccggcctc aattacgctt aaatacaaat tagtccataa gtctaaaaaa      1140
     ttacaatcca tttatatcaa gtcgattgtg gatgagcttc gcgaggctaa taattcagac      1200
     ttggacagct atttttttgg ccccctagct attgggtatc aaggaactgg aaaaaatttg      1260
     ctggagccag aatccaaaca aatagttatt aactatttag atgaagttcg ttacaaatat      1320
     acttcaaaag gtatcaaagc taatccaagt gactttcatc gaggcactac agcgccttat      1380
     tattttgaat tactcaaaca tatggataat taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page