(data stored in ACNUC7421 zone)

EMBL: CP000675.PE91

CP000675.PE91        Location/Qualifiers
FT   CDS_pept        complement(87728..88336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54091"
FT                   /protein_id="ABQ54091.1"
FT                   /translation="MDASKGNNHLKSLNKYSWFILVMFIFAVFAMSYQTTNTFFDGFIQ
FT                   TLPLIIVFVFWSEKSARLIKQAESNLKRAELFNRDTFILSFSFLLGCLISLLFAYDNSD
FT                   VKGWWVLIIYFITLYGLIFSLIFSGIALQIKNHKTYTLVFSLLIIVFVSMGKFFPRYTF
FT                   IPLLGYIDTFYAVTCVLLIIHCLFAFNCKIIRTIKRNTP"
     atggatgcat caaaaggaaa taatcacctt aaaagcttaa ataaatactc ctggttcatt        60
     cttgtaatgt ttattttcgc tgtattcgca atgtcgtacc agacaaccaa tacttttttt       120
     gatggtttta ttcaaacact tcctctaatt attgtcttcg ttttctggag tgaaaaatct       180
     gcacgactta taaaacaagc tgaaagtaat ttaaaaaggg cagaactctt taatcgggat       240
     acgtttatat taagctttag ttttttattg ggatgcctta tttcattact atttgcttat       300
     gataatagtg atgtcaaagg ttggtgggta ttaattattt acttcattac cttgtatggt       360
     ttaatttttt ctttaatttt ctcaggaata gcccttcaga taaaaaatca taaaacatac       420
     accctggttt tttcactttt aatcatagta ttcgtatcaa tgggaaaatt tttcccccgt       480
     tatacgttca ttccattgct aggatatatt gacactttct acgcagtaac ttgcgtattg       540
     ttaattattc attgtttatt tgcctttaat tgcaaaataa tcagaacaat taagagaaac       600
     acaccctaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page