(data stored in ACNUC7421 zone)

EMBL: CP000675.PE94

CP000675.PE94        Location/Qualifiers
FT   CDS_pept        92152..93765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0095"
FT                   /product="diguanylate cyclase/phosphodiesterase domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54094"
FT                   /protein_id="ABQ54094.1"
FT                   /translation="MNIKSNLAYSSVILKGHVNRYAFLGLLISVGSILIASCIVSYQLT
FT                   GSVSLGGFIQAQRTNPAIWILDLTPFMFVYWGQAFCYGLVNKAESLLVDKTKELLNISG
FT                   NLELKLKYESNHDSLTNLPNNRLLNEKIRLAIEQLGLQGELAVIVIKINDLNYNFSSFN
FT                   ANNIVKQFAEKLKSILIDPYMLKASLGINMVARLQSDEFAILMPRLKKDLDINELLIHL
FT                   LTLLNNNLMVDGISINVTSTVGAAIYPAHGEEDDVLVNHAIIAVYQARKENKSYAIYSP
FT                   EMEEDLIQNRIVMNELQRSIENKDLKIYYQPIVELANGQIVGAESSARFEHPELGLLSA
FT                   EKFMPLIEGTSLIHNLTTLMLKEVIKQLAAWHDAGHKIFVSVNLSVHHELPELIEKLLN
FT                   DYEIAPEFLKLEFTERACLTEQMVTKEVFDRLSTMGIKLCIDDFCSENSSFIHLTNFPI
FT                   ENIKIEKSFVLKIAKDAKKAKIVEAIVKLAQTLGWEPLADGIADQNALEKLRDLGCLYG
FT                   QGLYFSRAVNVAEFTSLLKK"
     atgaatatta aatctaattt ggcatatagc tctgttatcc tgaaaggtca tgtcaatcga        60
     tatgcctttt taggattgct tatttctgtt ggcagtatct tgattgcaag ttgtatcgtt       120
     tcctatcaat tgactggatc tgtgagttta ggcgggttta ttcaggctca aagaactaac       180
     ccggcaattt ggatcctgga tttaacacct tttatgtttg tgtattgggg gcaagcgttt       240
     tgttatggat tggttaacaa agcggagagt ttgctggttg ataaaaccaa agagctttta       300
     aatatcagtg gaaatctgga attaaagctc aaatatgaaa gtaatcacga tagcttgacc       360
     aatttgccta acaaccgctt gttaaatgaa aaaatacggc tcgccatcga acaattgggc       420
     ttacagggtg aattagctgt tattgtgata aaaattaatg atcttaatta taatttcagc       480
     tcatttaatg ccaataatat cgtaaagcaa tttgctgaaa aattaaaatc gattttgatt       540
     gatccctaca tgctaaaagc ttctcttgga attaatatgg ttgcaagatt gcaaagtgat       600
     gaatttgcca tattgatgcc gagacttaaa aaagatttgg atattaatga gctattaatc       660
     catcttctta ccttgctgaa taataacctg atggtggatg gaattagtat caatgtgaca       720
     tctaccgttg gtgctgctat ctatcctgcc catggagagg aagacgatgt tttagtaaat       780
     catgccatta ttgcagttta ccaggcacga aaagaaaaca aatcctatgc aatttacagc       840
     cctgaaatgg aagaagacct tatacagaat aggattgtga tgaatgaact gcagcgctcc       900
     attgaaaaca aagatttgaa aatttattac cagccaatag ttgaactggc taatggccaa       960
     attgtaggtg ccgagtcatc agctcgcttt gaacatcctg aattgggttt attaagtgca      1020
     gaaaaattca tgcctttaat cgagggaacc agtttaattc ataatttgac aactcttatg      1080
     cttaaggaag tcataaagca attagccgcc tggcatgatg ctggacataa aatttttgtc      1140
     tctgtaaatc tgtcagtgca ccatgagttg cctgaattaa tagagaaatt attaaatgat      1200
     tatgagattg ccccggaatt cttgaaactt gaatttaccg aaagggcttg tttaactgag      1260
     cagatggtta ccaaagaagt gtttgaccga ttatcaacca tgggcatcaa attatgcatt      1320
     gatgattttt gcagtgagaa ctcttccttc attcatttga ctaattttcc tatcgaaaac      1380
     attaaaattg agaaatcatt cgtactgaaa attgcaaaag acgcaaagaa agccaaaatt      1440
     gtagaggcta tagtaaaact agcccaaaca ttagggtggg aacccctggc agatggcatc      1500
     gctgatcaaa atgcattgga aaaattaaga gacttaggct gcttgtatgg ccagggatta      1560
     tatttttctc gagcggtcaa tgtggctgaa tttacatcat tgctaaagaa atga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page