(data stored in ACNUC7421 zone)

EMBL: CP000675.PE96

CP000675.PE96        Location/Qualifiers
FT   CDS_pept        complement(95505..95819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0097"
FT                   /product="conserved hypothetical protein; DUF710"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54096"
FT                   /protein_id="ABQ54096.1"
FT                   /translation="MTNIKLCKIKLLNKIYEIKCPDGEEVSLILAAEKLNEKMQNNKNK
FT                   FKHLDNFHILLLAALDIGHELIVCKNEQEQQRLQVTQFISSLENKINKAVVGSETDSNQ
FT                   "
     atgaccaata ttaaactctg taaaataaaa ttattaaata aaatctatga aatcaaatgc        60
     cctgatggcg aagaagtgag tttaatactc gcagcagaaa aacttaatga aaaaatgcaa       120
     aataacaaaa ataaatttaa acacctggat aattttcaca tccttttact tgctgctctg       180
     gacattggcc atgaattaat tgtatgtaaa aatgaacagg agcaacagcg attgcaggtg       240
     acccaattta tatcttcttt ggaaaataaa attaataaag cagtagttgg ctctgaaacg       300
     gatagcaatc aataa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page