(data stored in ACNUC7421 zone)

EMBL: CP000675.PE97

CP000675.PE97        Location/Qualifiers
FT   CDS_pept        95975..96556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0098"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54097"
FT                   /protein_id="ABQ54097.1"
FT                   /translation="MSLDNDSLHLPKYDDFVQSISVLALTMSGSELHGIMCGYLCAGAD
FT                   SQGEAYIRALLNNKKDEQSRNALLSMFSVFSISQQQMNNFDFEFEMLLPDDDESLVTRA
FT                   QAFSEWCEGFTQGLTIAGVGMEQFYEEESQDALQHLIEFAELDCESLEVGEEDERALME
FT                   VSEYTRMAVLRLHSDLVLHERELGDSGTTH"
     atgtctttag ataatgattc gctgcattta cctaagtacg atgattttgt gcaatccatt        60
     tctgttttag cattaactat gtccggaagc gaattacacg gaatcatgtg cggttatctg       120
     tgtgcagggg ctgatagtca aggcgaggct tacatacgcg cgttgctaaa taataaaaaa       180
     gatgagcaaa gtcgtaatgc gttattatcc atgttttctg tcttttcaat tagccagcaa       240
     caaatgaata attttgattt tgaatttgaa atgttattgc ccgatgacga cgaatcttta       300
     gtcactcgtg ctcaggcttt tagtgagtgg tgtgaaggat ttacgcaagg gttaactatt       360
     gcaggagttg ggatggagca gttttatgag gaggaatctc aggatgctct tcagcacctt       420
     atagaatttg cagagctgga ttgtgagtcg ttggaggtag gcgaggaaga tgagagagcg       480
     ttgatggagg tcagtgaata cactcgtatg gcagtacttc gattgcacag tgatttggtt       540
     ttgcacgaaa gagaacttgg agattctgga acaacccatt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page