(data stored in ACNUC7421 zone)

EMBL: CP000675.PE98

CP000675.PE98        Location/Qualifiers
FT   CDS_pept        96661..97971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54098"
FT                   /protein_id="ABQ54098.1"
FT                   /translation="MISQQEYKARRKKLAAQLPDDSVAVIPAAHEVLRSGDTHYRFRQD
FT                   SDFYYLTGFNEPDALLVIIAGKDSQSILFNRPRNPAEEQWTGKRLGQDGALQELGVQAA
FT                   YPLSSIAEELPKLFSGKSAIYYDLGRNLSLEKKIRHVLSSLKAQVRRGIKAPESLCDLE
FT                   PILSEMRLLKSDAELELMRQAARISVAAHKRAMQVCQKMEYEYQLEAELIYEFSRHGCR
FT                   SVAYDPIVGGGANACILHYTENNKPLRRGDLVLIDAGGEYGSYAADITRTFPVSGTFSP
FT                   EQKIIYELVLKAQKAGIAAIEPGLPWNHIQQTIIRILTEGLCDIGILKGDLEELIKNEA
FT                   YKPFYMHNSGHWLGLDVHDVGRYKINNEWRPLEAGMVLTVEPGLYISAGMEGVDKRWWD
FT                   IGVRIEDDILVTRAGYEVLTGDLPVNVDDIEALMRGE"
     atgataagcc aacaagaata taaggcgaga agaaaaaaat tagctgcgca attgcctgat        60
     gacagtgttg ctgtaatacc tgcagcacat gaagtgctgc gcagtggaga tactcattat       120
     cgatttcgac aggacagtga tttttattat ttaacaggat ttaatgagcc tgatgctttg       180
     ctggtcatta ttgcgggaaa ggatagccaa agtattttgt ttaatcgccc aagaaatcct       240
     gcagaagaac aatggacagg taaacgatta ggtcaggatg gcgctttgca agagcttgga       300
     gtgcaggcgg catacccatt aagcagtatt gcagaagagc ttcctaaact attcagcggg       360
     aaatctgcca tatactatga cctcggccgt aatttatcat tggaaaaaaa aatcaggcat       420
     gttttatctt cactaaaagc tcaggtgaga agaggcatta aggcacctga gtcgttatgc       480
     gatctcgaac ctattctaag cgaaatgcgt ttgcttaaaa gcgatgcgga attagagtta       540
     atgagacagg cagcccgtat ttcagtggct gctcataaac gagcgatgca agtttgtcag       600
     aaaatggaat atgagtacca actggaggca gaattaatct atgagtttag ccgtcatggc       660
     tgtcgtagtg tagcttatga ccctatcgtg ggtggtggcg ccaatgcctg cattcttcat       720
     tatacagaaa ataacaaacc tttgcgccgt ggcgatttgg tgctcattga tgcagggggc       780
     gaatatggta gttatgccgc agacattacc agaactttcc cggtaagcgg tacttttagc       840
     cctgagcaga aaatcattta tgaattggta ttgaaagcac aaaaagctgg catagcagcg       900
     attgaaccgg gccttccctg gaatcatatt cagcagacta ttatcagaat tcttactgag       960
     ggtctctgtg atataggaat tttaaagggc gatttggagg agctcattaa aaatgaagcc      1020
     tataaaccat tttatatgca taattcagga cattggttag gattggatgt gcatgatgtc      1080
     gggcgatata aaatcaataa tgaatggcgt cctttagagg ccggaatggt attaacagta      1140
     gaaccagggc tgtatataag cgcagggatg gaaggcgttg ataaacgatg gtgggatatc      1200
     ggtgtgcgta tagaagatga tattctggta accagggcgg gatatgaggt attgaccggt      1260
     gacttgcctg ttaatgtaga tgatattgag gctttgatgc gtggcgaata a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page