(data stored in ACNUC7421 zone)

EMBL: CP000675.PKN5

CP000675.PKN5        Location/Qualifiers
FT   CDS_pept        295371..298256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkn5"
FT                   /locus_tag="LPC_0283"
FT                   /product="serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54278"
FT                   /protein_id="ABQ54278.1"
FT                   /translation="MKLLRSHELKSLPSMDEKALELLIKVLSNKGIRKLIKSADGKPIS
FT                   REIMIREFGIDCQILFITTEESLKPIIVPTENKISGGGKSYCEQFKVYALDDGKTYFLK
FT                   SVKIDPESLIEFTNEKDTLSKLGRLVGTFFNEQTQVHYILTTFIKGIDLSRYKNSLPLS
FT                   VNLKHFWEVLGIMISVCHQVKQFHELGLIHRDLKPGNIMLDADMQCHLVDFGSSSSDKE
FT                   PKPASWGTSSYLAPELNAQEDFIAFSQASDLFALAYSLDELFNPFRQVKFAKVDIGIKN
FT                   KHLVLLHAEIEACITGLMSNETSARTLYFSRILQLQRVPDSFKSRPEAFTYMIMLLTQW
FT                   KSCYKIPEMNKELDEIIAEIKVAYENHEQDVVKIIALLEQLSKADGLLNSHKALLSVLI
FT                   KSLANVKQQEPGHDDILPRRFESDVVSRLIKTPTAKMMAAIKQVSDAIVKILEQYEHSP
FT                   TESFEHEVLQDFLEQMVQSDILFGAPKEKIEISDIIKILKANRTEDFVQIQHISFKFAQ
FT                   VALRDLALHDLPKHEPKGAFLEILQKYQAKYAPEETSLFELYHHMAGVRDHNPSKVKKG
FT                   EGYRFRAFICDELFYGDEIFSTGDNRGREGKPNQRLQTNQVGLMKFEHSAHTKGLLTLN
FT                   GQSWYADCKTQLPNYDSIHYLSALKTDCPYITGPSGMTSLFMNMMFLLLNPKDQDVILS
FT                   YSLGVMTYVVGAGYHSIKEILIPMVKCVGIMPDYPQHKGIEYLTASPLYNHYFKAIEEF
FT                   DKEFAEVHEKIWQEHLAYFHMTYMPVCMRDHCLPHQVPSMEDISSEVKEMLEIVSKSVK
FT                   NCLEEHQVKRTGDMGLFLSTSCGQTKALEVLSHVCQQQVGLTAIFRQIQAYFKGTFETE
FT                   EGITINREMQLKFIAHFFDVLKESPTLLSQFNLTLRIENTIGVHQCELGSSKRKELFLE
FT                   IKKTSIAANEERMVANHEPRKENCNVIILPY"
     atgaaattgc ttcggtctca tgaattaaaa tcattgccaa gcatggacga gaaagcattg        60
     gaattgttga taaaggtttt aagcaacaaa ggcattagaa aactaataaa atctgccgac       120
     ggcaagccta tatcacgtga aataatgatt cgtgagtttg gaatagattg tcaaattcta       180
     tttattacca ccgaggaatc tcttaagcca atcattgttc ccactgaaaa caagatttca       240
     ggaggtggta aatcttattg cgagcaattt aaagtttatg ctttggatga tggaaaaact       300
     tatttcctaa aatccgttaa gatcgatcct gaaagcttga tagagtttac caatgagaaa       360
     gacaccttaa gcaaattggg tcgcttggta ggaacttttt ttaatgagca aacccaggtg       420
     cattatattc tcacaacttt tataaaaggg attgatttat cccggtataa aaactcactt       480
     cctcttagtg ttaatctaaa acatttttgg gaagttctcg gcattatgat ttctgtatgc       540
     catcaggtga aacaattcca tgaattaggc ttaattcacc gcgatcttaa acctggaaat       600
     attatgctgg atgcggatat gcagtgtcat ttagttgatt tcggcagcag ttcttctgat       660
     aaagagccta aaccggcatc atggggaacc tcaagctatt tagcaccaga acttaatgca       720
     caagaggatt ttattgcttt ctctcaggct agtgatcttt ttgctttggc ctattctctg       780
     gatgaacttt ttaatccatt caggcaggtt aaatttgcga aagtggatat aggaattaaa       840
     aataagcatc ttgtgctttt acacgctgaa atcgaggcat gcattactgg gctcatgtca       900
     aatgaaacat cagcacgaac actttatttt tctcgcatcc tgcaattaca aagagtccca       960
     gatagtttca aatcgagacc agaagcattt acctatatga ttatgctgct tactcaatgg      1020
     aaaagctgct ataaaatacc ggaaatgaac aaagagttag atgaaatcat tgcagaaata      1080
     aaagtagctt atgaaaacca tgaacaggat gtcgtaaaaa ttatagcact gcttgagcag      1140
     ttatctaaag cggacgggct gcttaattct cataaagcct tactctctgt tttgattaaa      1200
     tcgcttgcta atgtcaagca acaagaaccc gggcacgacg acatcttgcc gcgtcgtttt      1260
     gaatcagacg ttgtgagccg cctgataaaa actccaacag ctaaaatgat ggcagcaatt      1320
     aaacaagttt cagatgctat cgtaaaaatc ctggaacaat atgaacattc ccctaccgaa      1380
     tcttttgagc atgaggtttt acaagatttt ctcgaacaaa tggttcaatc ggacattctt      1440
     tttggtgccc ccaaagagaa aattgagatt tccgatatta taaaaatact caaggcaaac      1500
     aggacggaag atttcgtaca aattcagcat atttctttta aatttgccca agttgcttta      1560
     cgcgatcttg ccttgcatga cctgccaaaa catgagccaa aaggtgcgtt tttagaaata      1620
     ttgcaaaaat atcaagcaaa atatgcgcct gaagagacat cactttttga gctctatcat      1680
     cacatggcag gtgttagaga tcacaaccca tcgaaagtaa aaaaagggga gggataccgc      1740
     tttagagcat tcatttgtga tgagcttttt tatggagatg aaatttttag taccggggat      1800
     aatcgtggcc gcgaaggcaa gcctaaccaa agattacaaa ctaatcaagt tggtttaatg      1860
     aagttcgaac attcagccca caccaaagga ctactgacgt taaatggtca atcctggtat      1920
     gctgattgta agacccagct accaaactac gattcaattc attatctctc agccctgaaa      1980
     acggactgcc cttatattac ggggccttcc gggatgactt cattatttat gaatatgatg      2040
     tttcttctgc tcaaccctaa ggatcaagat gtcattctct cttacagcct tggggtaatg      2100
     acttatgtag ttggtgctgg ttaccatagc attaaagaaa ttcttattcc gatggtcaag      2160
     tgcgtaggca ttatgcctga ttatccgcaa cataaaggaa tagagtatct tactgcctcg      2220
     cctttatata atcactactt taaggcgata gaggagtttg ataaagagtt tgcagaggtt      2280
     catgaaaaaa tttggcagga gcaccttgcg tatttccata tgacttatat gcctgtttgt      2340
     atgcgtgatc attgcctacc acatcaagtt ccctcaatgg aagatataag ctcggaagta      2400
     aaagaaatgc ttgaaattgt gtctaagtct gtgaaaaatt gcttagaaga gcatcaagtt      2460
     aagcgtactg gcgatatggg gttgtttctt tcaacatcat gtgggcaaac aaaggcgctt      2520
     gaggttttaa gtcatgtctg tcaacaacag gtagggctaa ccgcaatttt taggcagatt      2580
     caggcgtatt ttaaaggaac ttttgagaca gaggagggga taacaataaa tagagaaatg      2640
     caacttaaat ttattgctca tttctttgat gtattaaagg aaagcccaac actgctttca      2700
     caattcaatt tgaccttaag gatagaaaat acgattggtg tgcatcagtg cgaattggga      2760
     agctctaagc gaaaagagct cttcctggag attaagaaga cgtccattgc agcaaatgaa      2820
     gagcggatgg ttgcaaatca tgaacccagg aaagaaaact gcaacgtcat cattttgcca      2880
     tattaa                                                                 2886
//

If you have problems or comments...

PBIL Back to PBIL home page