(data stored in ACNUC7421 zone)

EMBL: CP000675.PLED

CP000675.PLED        Location/Qualifiers
FT   CDS_pept        complement(319469..321613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pleD"
FT                   /locus_tag="LPC_0305"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54300"
FT                   /protein_id="ABQ54300.1"
FT                   /translation="MNNTWHQTATGNRSISNYLRLSRTLLNVIFIIALSLLLIINIISY
FT                   NQVKNLLLAINWVSQSYEIIQTIDTCLYEVVSIESRQRFYLIRDSNNQHMVDVDEMKSA
FT                   LKLNLDKLEKLTRNNLEQNKRTNRFTDLIERRLNLLNQIVQLKAIGKFNTHENYDLLNQ
FT                   SQDMSNQVKSLGQEIKSVELVLLSERKASAVRRADRSSFTLISGGITSILFLLIAFILA
FT                   NSELSSREKTELQNQNTQTQLKKIIESTSDMIAAFDKEHRFITFNEAYQREFKRLFDKY
FT                   ISINLSLEKALVDIPENKKELAEIWKNSLQNNEENKTIELNTEHEKIVYEMSSKLIQNG
FT                   DNEINGVVHSVRNITKRVQEHTELQESYQKLANGMKELQEKNEQITLLVEMSDIMLACS
FT                   SQQELSDVLSKYSQRLLRFSSGYLFIMHPSKNYLEKTTSWGDPQPHELTFTPEQCWAIR
FT                   RGRVHHVDSSHIELLCGHVSFSLEQQDLSLLCVPLMAQNDIYGLLYLEVNLKQLPLFDE
FT                   NQRLLITAFAELTALALANVRLGESLRYQSIRDPLTGLYNRRYLEDFLFKQLHQAERTK
FT                   ASFAILMLDLDHFKKINDTFGHEAGDFVLKEIGQILNNDIRLGDVATRYGGEEFVLLLF
FT                   DVDANAAKTRADNLRSAISKLQVKYGAQYVGQVTASIGISIYPDDAKSPDELIEAADKA
FT                   LYQAKNKGRNMVLLFSEISS"
     atgaataaca cttggcatca aaccgccact ggaaaccgct ccatttcaaa ttatttgcga        60
     ttaagcagaa ctctccttaa cgtcatcttt attattgccc tttccctgct tttaatcatc       120
     aatatcatct cttataacca ggtcaaaaat ttactcttgg ccattaactg ggtttctcaa       180
     agctatgaaa tcatccaaac cattgatact tgtctttacg aagtagtcag catcgaatct       240
     cgccagcgat tttatctgat tcgagactca aacaatcaac atatggtcga tgtggatgaa       300
     atgaaatccg ctttaaaact gaatttagac aaactcgaga aattaaccag gaataatctg       360
     gaacaaaaca agcgtaccaa tcgttttact gatttaattg agcggagatt aaatttgtta       420
     aatcaaatag tgcagttaaa ggccattggc aaattcaata cgcatgaaaa ttatgattta       480
     ctgaatcaaa gtcaagacat gtctaaccag gttaaaagtc ttgggcaaga aatcaaatcc       540
     gttgaattgg tgctgttatc agaaagaaag gccagtgctg ttcgccgggc tgatagaagt       600
     agctttactt taatatcagg gggcataaca agcatcttgt ttttattgat cgcttttatt       660
     ctggcaaata gtgaattgtc atcgcgcgaa aaaaccgaat tgcagaatca gaatacgcaa       720
     acccaattaa agaaaatcat agaaagcacc agtgatatga tcgcagcttt tgacaaagaa       780
     caccgattta ttacttttaa tgaggcatat cagcgtgagt ttaagcgtct ttttgataaa       840
     tacataagca tcaatctgtc cctggagaaa gcgctcgttg atattcctga aaataaaaaa       900
     gagttagctg aaatatggaa aaattcttta caaaacaatg aagaaaataa aactattgaa       960
     ttgaataccg aacatgaaaa aattgtttat gaaatgagct caaaactcat tcaaaatggt      1020
     gataatgaaa ttaatggcgt ggtgcacagc gttcgcaata ttaccaaacg ggtacaagaa      1080
     catacggaat tacaagaatc atatcaaaaa ctggctaatg gaatgaaaga gctgcaagag      1140
     aaaaatgaac aaatcacctt actggttgaa atgagtgaca ttatgttggc ttgcagttcc      1200
     cagcaagaac tcagtgacgt tctgtccaaa tactcccaaa gactgctgcg attttccagt      1260
     ggatatttgt tcatcatgca tccgtccaaa aactatttgg aaaaaaccac cagttggggg      1320
     gatccccaac cacacgaact gacatttact cccgagcaat gctgggctat ccggcgcggt      1380
     cgagttcatc atgtagactc gtctcatatt gagttattat gtggacatgt ttcattttcc      1440
     ctcgaacagc aagatttatc tctactttgc gttcctttaa tggcccaaaa tgatatttat      1500
     ggcttgttat acctggaagt caatctaaag caactcccat tatttgatga gaatcaacgg      1560
     ttgttaataa ctgcatttgc tgagcttacc gcattggcac tggcaaatgt ccgcctggga      1620
     gagagtttac gctatcaatc tatccgcgat ccactcactg gattatacaa tcgccgttat      1680
     ttggaagatt ttctatttaa acagctacat caagctgaac ggacaaaagc ttcctttgcc      1740
     attttaatgc tggatttgga tcattttaaa aaaatcaatg atacttttgg ccatgaggca      1800
     ggagactttg tattaaagga gataggccaa attttgaata atgatattcg gctgggtgat      1860
     gttgcaactc gatatggggg tgaagaattc gtcctgttac tctttgacgt tgatgccaac      1920
     gccgctaaaa cgagagccga taatttgcgc tcagccattt ccaaattaca ggttaaatac      1980
     ggggcacaat atgttggaca ggtaaccgca tcaatcggga tctcgatata ccctgacgat      2040
     gccaaatccc ccgatgagct gattgaagcc gcggataagg ctttatacca agccaaaaac      2100
     aaaggcagga atatggtgct tttattctcc gaaatatcat cctaa                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page