(data stored in ACNUC7421 zone)

EMBL: CP000675.PTSH

CP000675.PTSH        Location/Qualifiers
FT   CDS_pept        complement(569151..569420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="LPC_2869"
FT                   /product="sugar transport PTS system phosphocarrier HPr
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2869"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56770"
FT                   /protein_id="ABQ56770.1"
FT                   /translation="MIKTKIKIINRLGLHARASAKFVSTAAKFQSHIDVTKDTQTVNGK
FT                   SIMGVMMLAANKGSELTLEIDGPDEERMNEALVELINNRFGESE"
     atgatcaaga ccaaaataaa gataatcaac agactcggtt tacatgctcg tgcctcagcg        60
     aaatttgtct caacagcagc aaaatttcaa agccatattg atgtaaccaa agatactcag       120
     accgttaatg gcaaaagcat tatgggtgtg atgatgcttg ctgctaacaa aggtagtgag       180
     ttgacgttgg aaattgacgg tccagatgaa gaacgcatga atgaagcttt agtcgaatta       240
     atcaataatc gatttgggga aagtgaataa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page