(data stored in ACNUC7421 zone)

EMBL: CP000675.PURE

CP000675.PURE        Location/Qualifiers
FT   CDS_pept        complement(306150..306650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="LPC_0294"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit PurE"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54289"
FT                   /protein_id="ABQ54289.1"
FT                   /translation="MKPILIGLIMGSQSDWQTLIHAAQTLDALNIGYEAEIVSAHRTPD
FT                   KLFQYAEQAEERGLEVIIAGAGGAAHLPGMVAAKTSLPVLGVPVMSQTLNGVDSLLSIV
FT                   QMPAGIPVGTLSIGKAGAINSALFAAAILANKYPDIRAALKRYREQQTQKVLDNPNPKE
FT                   EKS"
     atgaaaccca tattaatagg tctaattatg gggtctcaaa gtgattggca aacattaatc        60
     catgccgccc aaacactgga tgcgctcaac attggctatg aggcagaaat tgtctccgct       120
     cataggacac ccgacaaact tttccagtat gcggaacagg ctgaggaaag aggtttggaa       180
     gtgattattg ctggtgcagg aggagcggct catctcccag gcatggtagc agccaaaaca       240
     tctttgcctg ttttaggtgt tcccgtcatg tcacaaactt taaacggcgt cgattccttg       300
     ctatccattg tgcaaatgcc cgcggggata cctgtaggca ctttatcgat aggtaaagca       360
     ggtgccatca actccgcact gtttgcagcc gcaattcttg ctaataaata tcctgacatt       420
     cgagctgcct taaaacgtta tcgagaacaa caaacacaaa aagtgctcga caatccaaac       480
     cctaaagagg aaaagtcatg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page