(data stored in ACNUC7421 zone)

EMBL: CP000675.PURK

CP000675.PURK        Location/Qualifiers
FT   CDS_pept        complement(305074..306153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="LPC_0293"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54288"
FT                   /protein_id="ABQ54288.1"
FT                   /translation="MKLGILGGGQLARMLALAAYPLGINTVCLDPSPDACAGQLTKLIV
FT                   SDFNDELALKQFLSEVDCVTIETENIPFSCAELAAQIKPFYPSTQALKITQDRLYEKNF
FT                   FRTLNIPVPEFLPVESEDELMQAISVIGMPAVLKTRRFGYDGKGQYVLRTQADISKSWS
FT                   LLGSQALILEKLISFESEFSLIAVRNKSGETSFYPLIKNHHRKGILHFSEAPVHQDTLQ
FT                   QEAQTHAFKILEALNYVGVLTIEFFYQGNQLIANEIAPRVHNSGHWTIEGAHTSQFENH
FT                   LRALFDLPLGSTEVSGSCFLLNCIGNLLPLEPCLSIPGVHYHAYGKAPRPDRKVGHVTL
FT                   VDTDLERYTKSKDLLLDIS"
     atgaaacttg gtattctagg tgggggccaa cttgcaagaa tgttggcatt agcagcatat        60
     cctttaggga ttaacactgt ctgcctggat cccagtcctg acgcctgtgc tggtcaactc       120
     accaaactga tagtctctga ttttaatgat gaattggctt taaaacaatt tttgtcagaa       180
     gtggattgcg tcacaataga aaccgaaaat ataccttttt cttgcgccga attggctgcc       240
     caaataaagc ctttctatcc atcaacccaa gctttgaaaa ttacgcaaga cagattgtat       300
     gaaaaaaatt ttttcagaac tctgaatatt cctgtaccag aatttttacc ggttgaatca       360
     gaagatgaat tgatgcaggc tatttcagtt ataggaatgc ctgctgtgtt aaaaacaaga       420
     aggtttggct atgatggcaa gggccaatat gtcttgcgaa cccaagctga tatttcaaaa       480
     agttggagcc tgttaggcag ccaagctctc attcttgaaa aattaatctc ctttgaaagc       540
     gaattttcgt taattgctgt tcgtaataag agtggtgaaa caagtttcta cccattgatt       600
     aaaaatcatc acaggaaggg cattttacat ttctcagaag cccctgttca tcaggatacc       660
     ttacaacagg aggcgcaaac tcatgcattc aaaattttag aagccctgaa ttatgtcggt       720
     gtacttacca ttgagttttt ttatcaaggc aaccaattga ttgcgaatga gatagcgcca       780
     cgcgtacata attctggcca ctggactatt gagggagcac ataccagcca attcgaaaat       840
     catctgcgcg ctctttttga tttgcccttg ggaagcactg aagtgagcgg ctcttgtttt       900
     ttattaaatt gcattggcaa tctgctgcca ttggagccct gtttatcgat cccgggcgtt       960
     cattatcacg cctatggaaa agcaccccgg ccagatcgca aggtaggcca cgttaccctt      1020
     gtcgatactg atttggaacg ttatacaaaa agtaaagact tacttcttga catttcatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page