(data stored in ACNUC7421 zone)

EMBL: CP000675.PVCB

CP000675.PVCB        Location/Qualifiers
FT   CDS_pept        265702..266538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvcB"
FT                   /locus_tag="LPC_0257"
FT                   /product="pyoverdine biosynthesis protein PvcB"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54253"
FT                   /protein_id="ABQ54253.1"
FT                   /translation="MNYKVTSLKPFGVLLEPVSEKTKVTDVDIENLRHLFAKNQLVVLR
FT                   GFCAFQNAEDFSNYCELWGEVSLWPFGKVLELIEQEDPEDHIFDHSYMPLHWDGMYRPQ
FT                   VPEYQIFHCVKAPLPGQGGRTTFSNTILALQFASSEIKELWNKVCGTYQRKMEFYNSKT
FT                   VSPIIMKHPQKDFSVIRYNEPPSADKGHFVNPPDIEFTGIDQEELDFFHRSLNKALYSA
FT                   DNFYAHEWQNGDIVIADNFSLLHGREGFVSRSPRHIQRVHVLSNPPFDNPGLESYQ"
     atgaattata aagtgacttc tctaaaacca tttggagtac tcttggagcc tgtgagtgaa        60
     aaaacgaagg tgactgatgt cgatatagag aacttgcgcc atttatttgc aaagaatcaa       120
     ctcgttgtat taagaggctt ttgcgccttt caaaatgcgg aggatttttc taattattgt       180
     gagttgtggg gagaagtcag cctttggcca tttggcaagg tacttgagtt aattgagcaa       240
     gaggatccgg aagatcatat ttttgatcat agttacatgc ccttgcattg ggatggtatg       300
     tatcgacccc aggtgcctga atatcagatt tttcattgtg tgaaagcgcc tttgcctgga       360
     caaggaggaa ggaccacttt ttcaaacaca attttagcgt tacagtttgc ctcttcagaa       420
     atcaaagaat tatggaataa ggtgtgtggt acctaccaaa ggaaaatgga gttttataac       480
     agcaagacgg tatcaccaat tatcatgaag catcctcaaa aggatttttc agtcattcgc       540
     tacaatgaac ctccctctgc agataaaggt cattttgtaa atccacccga tattgaattt       600
     actggtattg atcaggaaga gttggatttt ttccaccgaa gtttaaataa agcactttat       660
     tcagcggata atttctatgc tcatgagtgg caaaacggag atatcgtcat tgcagataat       720
     ttttctttat tacatggcag agaagggttt gtctccagat cgcctcgcca tatccaacgc       780
     gttcatgttt tgagtaatcc gccttttgat aacccgggtc tggagtctta tcaatga          837
//

If you have problems or comments...

PBIL Back to PBIL home page