(data stored in ACNUC7421 zone)

EMBL: CP000675.PYKA

CP000675.PYKA        Location/Qualifiers
FT   CDS_pept        complement(171802..173226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="LPC_0157"
FT                   /product="pyruvate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54156"
FT                   /protein_id="ABQ54156.1"
FT                   /translation="MLRRTKIVATLGPASKEPEILRSMLAAGVNVVRINFSHADSSALQ
FT                   LIALVRKIADELNHPVAVMADLQGPKIRVGRFQNKSITLIDGQNFTLDCMAPDTLGDIN
FT                   GVSVAYPNLANELSISDHLLINDGLIELEVIEISGSKIHCKVVEGGVLTDLKGLNRKGG
FT                   GLAARTLTEKDRNDLRTAIEAEVDYISLSFVKDAEDIRQARALMKDYGAQITPIIAKIE
FT                   RMEALDHLTDIIREADAIMVARGDLGVEVGAAEVPAIQKHIIEQTRLLDKVVITATQMM
FT                   ESMISNPQPTRAEVSDVANAILDGTDAVMLSAETASGLFPVKVITMVNKICLSAEKHAS
FT                   FFYHSDLETCHYQRADQAIAMATMHTANHFPIQAIITLTESGDTALWVSRHHSTVPIFA
FT                   ISANKRTIGRLSLVNNVFPIYIDFHQFNPEGLNQQILHELIKSGHLEKRGYVLLTRGTQ
FT                   IGMPGGTNCMEIIPVV"
     atgttaagac gaactaagat tgttgccact ttaggcccag ccagcaagga acctgaaatt        60
     ctgcgatcca tgctggctgc tggagtcaac gtagtacgaa ttaatttttc tcatgccgat       120
     tcctctgccc tgcaattaat tgcactggtt cgtaaaatcg cagatgaatt aaaccacccg       180
     gttgcagtca tggctgactt acaagggcct aaaataagag tcggccgttt tcaaaacaaa       240
     tccatcactt taattgatgg acaaaatttt acattggatt gtatggctcc agatactctg       300
     ggtgatataa atggcgtatc agtggcttat cctaatttgg ccaatgaact cagtattagt       360
     gatcatcttc tgattaatga tgggttaatt gaattggaag tcatagagat ttccgggtca       420
     aaaattcatt gcaaggtagt ggaaggtgga gtactcactg atttgaaagg tttgaatcga       480
     aaaggtggcg gcttagcagc cagaactcta acagaaaaag atagaaatga tttacgtaca       540
     gcaattgaag cagaagtgga ctacatcagt ttatcttttg taaaagacgc agaggatatc       600
     cggcaagcaa gagcgctaat gaaagactat ggggcccaaa taacccctat tatcgctaaa       660
     attgagcgca tggaagcttt ggatcactta actgatatta ttcgcgaagc agacgccatt       720
     atggtggcca gaggagattt aggcgttgaa gtgggtgctg ctgaagttcc cgctattcaa       780
     aaacacatca tagaacaaac gcgactttta gataaagtgg tgattaccgc aacacaaatg       840
     atggaatcca tgataagcaa tcctcagcct acccgtgccg aggtttctga tgtagccaac       900
     gcgattctgg atggaactga tgctgtgatg ctttcggctg aaacagcaag cggccttttt       960
     ccagtcaaag tcattaccat ggtcaataaa atatgtttaa gcgctgagaa acatgccagc      1020
     tttttttatc atagtgatct ggaaacctgt cattatcaac gggctgacca ggcaatcgct      1080
     atggctacca tgcataccgc caatcatttt cccattcagg ccattatcac tctgaccgaa      1140
     tccggagaca cggctttatg ggtatcccga caccacagca ccgttcctat ttttgctata      1200
     tcagccaata agagaaccat tggtcgttta agccttgtaa acaatgtctt tcctatctac      1260
     attgattttc atcaattcaa ccctgaagga ttgaatcaac aaattttaca tgaattaatc      1320
     aaatcagggc accttgaaaa gagaggctat gttttgttaa ctcgtggaac ccaaattgga      1380
     atgcctggcg gcaccaactg catggaaatt atacctgttg tctga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page