(data stored in ACNUC7421 zone)

EMBL: CP000675.QXTA

CP000675.QXTA        Location/Qualifiers
FT   CDS_pept        286787..288157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qxtA"
FT                   /locus_tag="LPC_0274"
FT                   /product="cytochrome D ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54270"
FT                   /protein_id="ABQ54270.1"
FT                   /translation="MLVELLSRIQFGFSIGFHILFPTLNLGLAVFLVIMEALWLKTKNP
FT                   VYLEICKFWTKIFALTFGMGVVSGIVLAYQIGTNFGPFITQFGNVLGALFAYETLTAFF
FT                   LEAGFLGVMLFGWKRVPPALHFIATLLVTIGTTVSAFWIMSANSWMQAPSGYQLIEGKY
FT                   VVDSWWAVVFNPTFIPRFIHMLLASYVTTCFVIMAVSGFYFLRKQSTAIAKKSLSFSLW
FT                   ASLILVPLQIGVGDVVGINVHHYQPLKTAAMEGIWETQKGAPLLLFAIPSQTQQKNFYE
FT                   VGIPKLASLINTHEWNGEMIGLSSVGNEEQPRMAPVFFSFRIMVGIGLIMLFTAIAGFI
FT                   LRLRGTLFENSWFHRWCIVMAPLGFIASIAGWLTAELGRQPWVVHGLLKTRDSVSAIGV
FT                   EEVIISFVLLIVAYGVVFGFYLYYLLRLISHGPGILEEDEVEHHAFQYMTDFPKEKK"
     atgctcgtag agttattatc ccgcattcaa ttcggtttta gcattggttt tcatattcta        60
     tttccaactt taaaccttgg ccttgcggtt tttcttgtta tcatggaagc cctgtggctg       120
     aaaacaaaaa atcccgttta tctcgaaata tgcaagttct ggactaagat ttttgctttg       180
     acttttggta tgggagttgt ctccggcatt gtgttggctt atcaaattgg taccaatttt       240
     ggacccttca ttactcagtt tggaaacgtc ctgggggctt tgtttgctta tgaaacgttg       300
     accgcttttt tcctggaagc tggcttttta ggagtcatgc tttttggttg gaaaagagtt       360
     cctccagcac ttcattttat cgccaccctt ttggttacca taggaacaac cgtatccgct       420
     ttttggatca tgtcagccaa ttcatggatg caggcaccca gcgggtatca actcattgaa       480
     ggtaaatatg ttgtcgatag ttggtgggcc gttgttttta atcctacctt cattcccaga       540
     ttcattcata tgctgttagc ttcttatgta acgacttgtt ttgtcatcat ggcggtatcc       600
     ggattttact ttttaaggaa acaatctact gcaattgcta aaaaaagttt atctttcagt       660
     ttgtgggcat cgttgatttt agttccttta caaataggag tgggtgatgt cgtaggtatt       720
     aatgtgcatc attaccaacc actaaaaaca gctgctatgg aaggcatatg ggaaactcaa       780
     aaaggagcgc cgcttttgtt gtttgctatc ccctcacaga cacagcaaaa aaatttttat       840
     gaagtgggaa taccaaaact ggcaagtttg atcaatacac atgagtggaa cggtgaaatg       900
     atcggtttga gttctgttgg caatgaagag cagccgcgca tggctcctgt atttttttcc       960
     tttcgtatta tggtgggtat tgggctcatc atgttattta cggctatcgc tggttttatc      1020
     ttgcgcttaa gaggaactct ttttgaaaat tcatggtttc atcggtggtg cattgtaatg      1080
     gcaccactcg gttttattgc cagtatcgct ggatggttaa ccgctgaact tggacgacaa      1140
     ccctgggttg tccatggtct tttaaagacg agagactctg tttctgcaat aggggttgaa      1200
     gaagttatta tttcttttgt cttgctcatt gttgcctatg gagtggtctt tggattttat      1260
     ctctattatc tgctgaggct catctctcat ggacctggaa ttcttgaaga ggatgaagtg      1320
     gaacatcatg cttttcaata tatgaccgat ttccccaagg agaaaaaata a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page