(data stored in ACNUC7421 zone)

EMBL: CP000675.RECF

CP000675.RECF        Location/Qualifiers
FT   CDS_pept        3127..4188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LPC_0003"
FT                   /product="DNA recombination and repair protein ATPase RecF"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54003"
FT                   /protein_id="ABQ54003.1"
FT                   /translation="MILSEVRIHNFRNIASTSLILNPNFNCITGPNGSGKTSLLEALYM
FT                   LSCAHSFRSREVAPIISYGQNQLNVFAHTYDESTISVQKSITDGTQIKLNNQFCCTTSQ
FT                   LAYALPCQVIYSDIFQIIDAGPSVRRSLLDWGLFHVKHDYLKIWKDYKRILSQRNALLK
FT                   SRATYEHFIPWDQQLSQLANQLDKARNDYFLQWQPKFYQVLSDLTNISCTIEYYKGWDR
FT                   KNAGQNMEELLQKSFDSDKNKLYTQYGPHQADLIINIEQYRVKHTLSRGQQKIILIALK
FT                   LAQGQLLDKDCLYLIDDLAAELDDYHQRNLIKYLTQQKGQFVITNLINNNNYDILPIDS
FT                   GLFEVNCGAIKVL"
     atgattttat ctgaagttag aattcataat tttcggaata tcgcttcgac tagtttaatc        60
     ctaaatccca attttaattg tattacagga cctaatggca gtggtaaaac atcgttatta       120
     gaggctcttt acatgttgag ctgcgcccat tcttttcggt ctcgtgaagt agctccaatt       180
     atttcttatg gtcaaaacca acttaatgtt tttgcccata cttacgacga aagcactatt       240
     agtgttcaga aatctataac agatggcaca caaattaaat tgaataacca gttttgttgt       300
     actacaagtc aactagccta tgcgcttcct tgccaggtta tttattctga tatttttcaa       360
     attattgatg ccggcccctc ggtaaggaga agcttacttg attggggatt gtttcacgtg       420
     aaacatgatt atttgaaaat ttggaaggat tacaagcgca tacttagcca acgaaatgcc       480
     ttattaaaat ccagagctac ttatgaacat tttattcctt gggaccaaca gctaagtcaa       540
     ttggcaaatc aactggataa agctagaaat gactattttt tgcaatggca acctaaattc       600
     taccaagtct taagtgattt aaccaatata tcctgcacaa ttgagtatta caaagggtgg       660
     gatagaaaaa atgcagggca gaacatggag gaactacttc agaaatcctt tgatagtgat       720
     aaaaataagc tatatacgca atatggaccc caccaagctg atttgataat taacattgag       780
     caatacagag taaagcatac actctctcgt ggacaacaga aaatcattct aatcgcactt       840
     aaattggctc aaggtcagct attagataag gattgcttat accttattga tgatttggct       900
     gctgagttag atgactatca ccagcgaaat ttaattaagt atctgacaca gcagaagggt       960
     cagtttgtta taacaaattt aattaacaac aataattacg atatcttgcc aattgactct      1020
     ggtttgtttg aagtaaactg tggcgcaatt aaagttttat aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page