(data stored in ACNUC7421 zone)

EMBL: CP000675.RECN

CP000675.RECN        Location/Qualifiers
FT   CDS_pept        338543..339310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="LPC_0316"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54311"
FT                   /protein_id="ABQ54311.1"
FT                   /translation="MWYQNIMRNLLEKLPEASRKDGEIFLSKLFLAVKKVDNKPEMEFF
FT                   LGLIEKSFLKFENEKSGSVTLAKFSRYILGLTLLYLKSSNDLAIWNSDFIPSLTEIKKC
FT                   LEAEKAGKPFYKFINQLEVETFASLNHQLAIDFNHFSAILKRNSDLKTIQSFTEACKGL
FT                   GNDVSQGFSQVMQDAEAHMINLQFAVDFDSGFGHESTDENQGNTKLQKPSHVNYMSMSA
FT                   NNLHRLGIFKLLAMSDGLSDQSNLFINQNNELR"
     atgtggtatc aaaatataat gcgcaatttg cttgaaaaac ttccggaagc aagtagaaaa        60
     gatggagaga tttttttaag taaactgttt ctggctgtta aaaaagtaga caataagcct       120
     gaaatggaat tctttttagg ccttattgaa aaatcttttt taaagtttga gaatgaaaaa       180
     tccggctctg tcactttagc caaattctcc aggtatattt tggggctcac cctgctctat       240
     cttaaatcaa gtaatgactt agccatatgg aattcagatt ttattccaag cctaacagaa       300
     attaagaaat gtcttgaggc ggaaaaagcg ggtaaacctt tttataagtt tatcaaccaa       360
     cttgaagtgg aaacttttgc cagtttaaat catcaactcg ctattgactt caatcatttc       420
     agcgccattc taaaaagaaa cagtgatttg aaaaccattc aatcttttac cgaagcttgt       480
     aaaggattgg gtaatgatgt ttcgcaaggg tttagccaag tgatgcagga cgcagaggcg       540
     cacatgataa acttgcagtt tgctgttgat tttgattctg gttttggcca cgagagcact       600
     gatgaaaatc agggtaatac taagttacaa aagccttctc atgtcaatta catgtctatg       660
     agtgcaaaca acttgcatcg actgggaata tttaaattac ttgcaatgtc tgatggatta       720
     agcgaccaaa gcaatttgtt tataaatcaa aataatgaac taagatag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page