(data stored in ACNUC7421 zone)

EMBL: CP000675.RIMK

CP000675.RIMK        Location/Qualifiers
FT   CDS_pept        505573..506481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="LPC_2929"
FT                   /product="glutathione synthase, ribosomal protein S6
FT                   modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2929"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56830"
FT                   /db_xref="GOA:A5IHI0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHI0"
FT                   /protein_id="ABQ56830.1"
FT                   /translation="MKIAILATNPHLYSHKRLKAEAEAAGHEVKIINPLYCYMNVAASN
FT                   PKVHYRGGAPLPHFDAVIPRIGASITYYGTAVLRHMETMGMYTLNESIAISRSRDKFRS
FT                   LQLLARKGIPMPLTSFAQSPDDTEDLIHMVGGAPLVIKLLEGTQGKGVILADSHQSAVS
FT                   IINAFKEMHANILVQEFIEESRGTDIRCFVIGEKVVAAVKRQAKDGEFRANVHQGGKAV
FT                   KVKLSPQERAIAVSAAKTMGLRVAGVDLIRSNHGPLVLEINSSPGLEGIEKATNINLAG
FT                   KIIEYIEKKAKPISSNHRFHG"
     atgaaaattg cgatattggc aactaacccc catttgtatt ctcataagcg tttaaaggcg        60
     gaggctgagg ctgcggggca tgaggttaaa attattaacc ctttatattg ttatatgaac       120
     gtggctgctt ctaatcctaa ggtacattat cggggtggtg cgcctttacc gcattttgat       180
     gccgttattc ctagaattgg cgcatccatt acctattatg gtacggcagt attgcgtcat       240
     atggaaacaa tgggcatgta cactcttaat gaatccatag ctatatcacg atccagggat       300
     aaatttcgct ctttgcaatt gctggcacgt aaaggaattc ctatgccgtt aaccagtttt       360
     gcccagtctc ctgatgatac tgaagatttg attcatatgg ttggtggggc tcctctggtc       420
     ataaaattat tagaaggaac acaaggcaaa ggagtcattc ttgctgacag tcatcaatca       480
     gctgtgagta tcatcaatgc ttttaaagaa atgcatgcca atattttggt ccaggaattc       540
     attgaagaat cccgaggtac ggatatacgt tgttttgtca taggagaaaa agtagttgcc       600
     gcagttaaac ggcaggccaa ggatggggag tttcgcgcaa atgtccatca aggaggaaaa       660
     gcagtaaaag tcaaactctc cccacaagaa cgggcaatcg ctgttagtgc cgcaaaaaca       720
     atgggattaa gagttgccgg agtggatctg attcgctcaa atcatggtcc attagtgcta       780
     gaaattaact cttctccagg tcttgaaggt atagaaaaag caactaatat taatttggca       840
     ggaaaaatca ttgaatacat tgagaaaaaa gcgaagccaa ttagttccaa tcatagattt       900
     catggataa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page