(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLC

CP000675.RPLC        Location/Qualifiers
FT   CDS_pept        437174..437824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="LPC_3013"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56914"
FT                   /db_xref="GOA:A5IHR4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR4"
FT                   /protein_id="ABQ56914.1"
FT                   /translation="MMIGLLGRKIGMTRVFTPEGVSVPVSVVEVQPNRVSQVKTAANDG
FT                   YSAVQLTGGTKKSSKVSKPVAGHFAKAQIDAGDMQVEFRIDSEDAFTPGQVISVADVFT
FT                   AGQYVDVSGLTKGKGFAGTVKRHNFRTQDASHGNSRSHRVPGSIGQNQTPGRVFKGKKM
FT                   AGHMGNARCTIQSLELVKVDSERNLLLIKGAIPGAPGSRVEIKPAVKKQARGE"
     atgatgatcg gtttattagg ccgtaagatc ggtatgacgc gtgtcttcac accagaagga        60
     gtttctgttc ctgtttctgt tgttgaggtt cagccgaatc gcgtttctca agtaaaaaca       120
     gccgcgaatg atggttattc agctgtacaa ttaactggtg gtacaaagaa atctagcaaa       180
     gtgagtaagc ctgtggctgg gcattttgct aaagcacaaa tcgatgctgg tgatatgcaa       240
     gtagaatttc gtatagattc agaggatgca tttacaccgg gtcaagtcat atctgttgca       300
     gatgtattta ctgccggaca atatgttgat gtatcgggtc tgactaaagg taaaggtttc       360
     gcaggaactg taaaacgaca taactttaga actcaagatg catcgcatgg taactcaaga       420
     tcacatagag tacctggttc tataggacaa aaccaaaccc ctggtcgtgt ttttaaaggg       480
     aaaaaaatgg ccggtcacat gggtaatgct cgatgtacaa ttcaaagtct ggaattggta       540
     aaagttgact ctgaaagaaa tttattgctc attaaaggtg caattcctgg tgctccaggt       600
     tctagagtag aaattaagcc tgcagtcaaa aagcaagcac gaggtgagtg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page