(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLD

CP000675.RPLD        Location/Qualifiers
FT   CDS_pept        437824..438429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="LPC_3012"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56913"
FT                   /db_xref="GOA:A5IHR3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR3"
FT                   /protein_id="ABQ56913.1"
FT                   /translation="MEITTIDTKSKLKLNKEIFAYTYNEGLVHQAVVTFMNNARSGNSA
FT                   QKTRSEVSGGGKKPWNQKGTGRARAGTIRSPLWRSGGVTFASKKRDYSQKLNKKMYKRA
FT                   LRSIISELCRTGNLVVVSDFQCDNHKTKDFLKKMNQMEISNALIIMSEVGENEYLGSRN
FT                   LIDYDICDVTTIDPVSLLRFEKVVVTEAAIKKIEEQLQ"
     atggaaatta ctacaataga tacaaagtca aaattaaagc taaataaaga gatatttgct        60
     tatacataca acgaaggctt ggttcatcaa gcagtagtta ctttcatgaa caatgctcga       120
     agcggtaata gcgctcagaa aactcgttct gaagttagtg gtggtggtaa aaagccctgg       180
     aaccaaaaag gaacaggtcg tgcgcgagca ggaaccattc gcagcccatt atggagaagt       240
     ggtggagtaa catttgcatc taaaaaaaga gattattcac aaaagcttaa taaaaaaatg       300
     tacaaacgtg cattacgtag tataatctcc gaactttgcc gcactggcaa cttggtggtt       360
     gttagtgatt tccaatgtga taatcacaag accaaggatt tcctcaaaaa aatgaatcag       420
     atggaaataa gtaatgctct gattataatg agtgaagttg gtgaaaatga ataccttggt       480
     tcaagaaacc tgattgatta tgatatctgt gatgttacaa ctatagatcc tgtttcctta       540
     ctacgatttg aaaaagttgt tgttacagaa gctgcaatta aaaaaattga ggaacagtta       600
     caatga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page