(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLE

CP000675.RPLE        Location/Qualifiers
FT   CDS_pept        442554..443105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="LPC_3001"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56902"
FT                   /db_xref="GOA:A5IHQ2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ2"
FT                   /protein_id="ABQ56902.1"
FT                   /translation="MARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVG
FT                   DKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLDRLI
FT                   SITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSAKTN
FT                   EEAKALLEAFNLPLKDKDRK"
     atggcgagac ttaaagaatt ttataagaaa gacgtcgtca ctatgatgat gaaacggttc        60
     aactattcga gtgtgatgga agtacccagg attctcaaaa taactcttaa tatgggagtt       120
     ggagaagctg ttggtgacaa aaaagtcatg aatcatgcga ttgaagacat gacgctgatt       180
     tctggtcaga aaccagtcgt tacaaaagcc agaaaatcaa tagctggttt taaaataaga       240
     gagggatggc caataggttg taaggtaacg ctcagacgtg aacgtatgta tgagtttcta       300
     gatagattaa tatctattac tttacctcgt gtaagagatt ttcgtggttt gaatccaaaa       360
     tcttttgatg gaacaggaaa ctacagcatg ggaatacatg agcaaatcgt gtttccagag       420
     attgattatg ataaaacaga cggaatacgc ggtttagata tttgtattac aacaagtgct       480
     aaaacaaatg aagaagctaa agctttgtta gaagcattta atcttccact gaaagacaaa       540
     gatagaaaat aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page