(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLR

CP000675.RPLR        Location/Qualifiers
FT   CDS_pept        444406..444765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="LPC_2997"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2997"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56898"
FT                   /db_xref="GOA:A5IHP8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP8"
FT                   /protein_id="ABQ56898.1"
FT                   /translation="MNKQNARHRRGLKAKALIRKTGRSRLVVYRSGVHIYSQIVKSDQL
FT                   GDKVLVASSTIDKELRSSLTGKSKVEQASLVGQLLGKRAKAAGITQVAFDRAGYKYHGR
FT                   VKALAEGAREAGLDF"
     atgaataagc aaaacgcacg acatagacgt ggattaaaag ccaaagcctt aatacgcaaa        60
     acaggccgct caagattagt tgtgtatcga agtggtgtgc atatttattc tcaaattgtc       120
     aagtcagacc agcttggtga taaggtgttg gtagcatcat ctactataga taaagaattg       180
     agatccagtt tgactggaaa aagtaaagtt gaacaagcca gtttagttgg tcaactattg       240
     ggtaagcgtg ctaaggctgc aggcattaca caggttgcat ttgacagagc aggttataaa       300
     tatcatggca gagttaaagc acttgctgaa ggtgcacgcg aagccggatt agatttttaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page