(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLS

CP000675.RPLS        Location/Qualifiers
FT   CDS_pept        complement(490550..490915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="LPC_2947"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2947"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56848"
FT                   /db_xref="GOA:A5IHJ8"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHJ8"
FT                   /protein_id="ABQ56848.1"
FT                   /translation="MTNIIDQINAEQMQGKEIPDFNPGDTVLVQVKVIEGNRERLQAFE
FT                   GVVIAKRNRGLNSAFTVRKISHNVGVERVFQTYSPIVDSITVKRRGDVRRAKLYYLRNL
FT                   AGRAARIKEKLSGKKGD"
     atgactaata ttattgacca aattaatgcc gaacaaatgc aaggcaaaga aattcctgat        60
     ttcaacccag gcgatactgt tctggtccaa gtaaaagtta ttgaaggtaa ccgtgagcgt       120
     ttacaggcat ttgaaggcgt tgtgattgcc aagcgtaacc gtggactaaa ctctgctttc       180
     actgtacgta aaatttccca taacgttggt gtagagcgcg ttttccaaac ctacagtcct       240
     attgttgata gtattacggt gaaaagacgt ggtgacgttc gtcgtgccaa attatattac       300
     ttaagaaatc ttgctggccg cgcagctcgt attaaagaaa aattatctgg gaagaaaggc       360
     gattaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page