(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLV

CP000675.RPLV        Location/Qualifiers
FT   CDS_pept        439868..440203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="LPC_3008"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56909"
FT                   /db_xref="GOA:A5IHQ9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ9"
FT                   /protein_id="ABQ56909.1"
FT                   /translation="MEVTAKLKGAPLSAQKGRLVADMIRNMNVSGALDVLKFTPKKGAK
FT                   LMLKLLESAIANAENNNGADIDDLKVGMVCVDEATTLKRISPRAKGRANRICKRTCHIT
FT                   IKVSDEE"
     atggaagtaa cagctaaatt aaaaggcgct cctttatccg ctcaaaaggg tagattagta        60
     gccgatatga tacgtaatat gaatgtgtct ggtgcgcttg atgtcctcaa gtttacacca       120
     aaaaagggtg ctaaattaat gcttaaatta ttagagtcag ctatagcaaa tgctgaaaat       180
     aataatggag ctgatattga tgatctgaaa gtaggcatgg tatgcgttga tgaagcaaca       240
     actttaaaac gtattagtcc cagagctaag ggtagagcaa atcgaatttg caaacgtacc       300
     tgccatataa ctattaaagt gtctgacgag gaatag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page