(data stored in ACNUC7421 zone)

EMBL: CP000675.RPLX

CP000675.RPLX        Location/Qualifiers
FT   CDS_pept        442209..442538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="LPC_3002"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56903"
FT                   /db_xref="GOA:A5IHQ3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ3"
FT                   /protein_id="ABQ56903.1"
FT                   /translation="MKRIKSGDEVIVIAGKSKGHIGKVLRVIDDAVVVEGGNLIKKHIK
FT                   PNPQKPENKGGIITREAPLHVSNVAHYNPVTKKADKVGFKYLESNGVSKKVRYYKSNNE
FT                   IIDRI"
     atgaaacgta ttaaatcagg cgatgaagta attgtaattg ccggtaaaag taaaggtcat        60
     ataggtaagg ttttaagggt aattgatgat gccgttgtag tagaaggcgg aaatctaatt       120
     aaaaagcata tcaagcctaa tccacaaaag cctgaaaata agggtggtat tataacgcgt       180
     gaagctccat tgcacgtttc aaatgttgct cactataatc ctgttacaaa aaaggctgat       240
     aaggtcggct ttaaatatct tgagagtaat ggtgttagca aaaaggttag atattataag       300
     tctaacaatg aaataattga ccgtatatag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page