(data stored in ACNUC7421 zone)

EMBL: CP000675.RPMB

CP000675.RPMB        Location/Qualifiers
FT   CDS_pept        complement(571722..571958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="LPC_2865"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2865"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56766"
FT                   /db_xref="GOA:A5IHB6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHB6"
FT                   /protein_id="ABQ56766.1"
FT                   /translation="MSRVCQVTGKRPMVGHKVSHANNKTKRRFLPNIQNHKFWVEEENR
FT                   FVTLRLSTKGMRIIDKLGIKAVLDKIRAKGEKI"
     atgtctagag tatgtcaggt aactggcaag cgacccatgg ttggtcataa agtgtcgcac        60
     gctaataaca aaaccaaaag acgcttcctg cctaacattc agaatcataa attctgggtt       120
     gaagaagaaa atcgatttgt caccttgcga ttaagtacca agggtatgag aattattgac       180
     aagttaggca taaaggcagt tctggataaa atcagagcta aaggcgagaa gatataa          237
//

If you have problems or comments...

PBIL Back to PBIL home page