(data stored in ACNUC7421 zone)

EMBL: CP000675.RPMG

CP000675.RPMG        Location/Qualifiers
FT   CDS_pept        complement(571543..571707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="LPC_2866"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2866"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56767"
FT                   /db_xref="GOA:A5IHB7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHB7"
FT                   /protein_id="ABQ56767.1"
FT                   /translation="MAAVTIKVKMESTAGTGYYKTTTKNPRNHPEKMELMMYDPKVRKH
FT                   VLFKEKKVK"
     atggcagctg ttacaattaa agtgaaaatg gaatccacag caggaactgg atactataaa        60
     accactacta aaaatccacg taaccatcct gaaaagatgg aattaatgat gtatgaccct       120
     aaagtacgaa agcacgtact gttcaaagag aaaaaagtaa aataa                       165
//

If you have problems or comments...

PBIL Back to PBIL home page