(data stored in ACNUC7421 zone)

EMBL: CP000675.RPOA

CP000675.RPOA        Location/Qualifiers
FT   CDS_pept        448876..449868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="LPC_2990"
FT                   /product="DNA-directed RNA polymerase alpha subunit RpoA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2990"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56891"
FT                   /db_xref="GOA:A5IHP1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP1"
FT                   /protein_id="ABQ56891.1"
FT                   /translation="MYTEINEMLTPKVLKVQAESPYKARIVLEPLERGFGHTLGNALRR
FT                   ILLSSMPGSAITEASIDGVLHEYSTIEGVQEDVVDLLLNLKSVAIKLTVGNEAQVTLNK
FT                   EGPCQVTAGDIQLTHGQEIINPELVIANLNEKGKLNMTLKVERGIGFHNTDAFVRYHED
FT                   EIEKKTVGKLKIDNSFSPVKKVAYFVDSARVENRTDLDKLTIELETNGTIDAEEAIRIS
FT                   ASILQRQLHAFVDMKFEESRADNKERNDFDPVLLRSVDDLELTVRSANCLKAENIHYIG
FT                   DLVQRTESELLKTPNLGKKSLTEIKDVLASRSLSLGMKLENWPPASLGE"
     atgtatactg aaatcaatga aatgttgacg cctaaggttc tcaaagtaca ggccgagtcg        60
     ccctataaag ctagaatagt tttagaacct ttggagcgag gttttggtca caccctcggc       120
     aatgctttga gaagaatctt attgtcatcc atgccaggca gtgccattac tgaagcttct       180
     attgatggtg ttttgcatga atatagtact attgaaggtg ttcaggaaga tgtggttgat       240
     ttgttgctta acctaaaatc agttgctatc aaattgactg taggaaacga agcgcaggtt       300
     accctaaata aagaaggacc atgtcaagtt acagctggtg atattcagtt gactcatggt       360
     caagaaatta ttaatccaga acttgtcata gccaatctca atgaaaaggg taaattaaat       420
     atgactctta aagttgaaag aggtattggc tttcataata ctgatgcatt tgttcgctat       480
     catgaagatg aaattgagaa aaagacggtt ggaaagttaa aaattgacaa cagtttttct       540
     ccagtgaaga aagtagctta tttcgtcgac agtgcacgtg tagaaaacag aacagattta       600
     gataagctta ctattgaatt agaaactaac ggtactatcg atgctgaaga ggcaataaga       660
     atatctgcta gtatactgca aagacagctt catgcgtttg ttgacatgaa atttgaagaa       720
     tcacgtgctg acaataaaga gcgtaatgat tttgatcctg tattattacg ttcagtggat       780
     gatttggagt tgactgttcg atcagctaat tgtttaaaag ctgaaaacat tcattatata       840
     ggcgatttgg ttcaaagaac agaaagtgaa ttattgaaga cacctaatct tggtaagaaa       900
     tcactaactg aaattaaaga cgttttagcg tcacgatcat tatcgctggg tatgaaactt       960
     gagaattggc cgccagcaag ccttggcgag taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page