(data stored in ACNUC7421 zone)

EMBL: CP000675.RPSC

CP000675.RPSC        Location/Qualifiers
FT   CDS_pept        440206..440862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="LPC_3007"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56908"
FT                   /db_xref="GOA:A5IHQ8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ8"
FT                   /protein_id="ABQ56908.1"
FT                   /translation="MGQKVNPIGIRLGIIKDWNSKWFAGKRYAEFLIQDIKLRNDLKKK
FT                   LMAAAVSKILIERPANNAVVTILTARPGVIIGKKGGGIETLRKEISDNLGVPVHLNIEE
FT                   VKKPELDATLVAEGIAQQLEQRVMFRRAMKRAVTSALKAGAKGIKICVSGRLGGAEIAR
FT                   SEWYREGRVPLHTFRADIDYGTAESKTTYGIIGVKVWIFKGEILPQKKRSTESAQ"
     atgggacaaa aagtaaaccc aataggtata cgccttggaa taattaaaga ttggaactca        60
     aaatggtttg caggaaagcg atatgctgag tttttaattc aggatataaa actacgtaac       120
     gatcttaaaa agaaattgat ggctgcagct gttagcaaga tacttattga gcgaccagcg       180
     aataatgctg ttgtgactat cttaacagca agaccaggtg ttattatcgg caaaaaaggc       240
     ggaggaattg aaacacttcg taaagaaatt tccgataacc tgggtgtgcc agttcatttg       300
     aatattgaag aagtgaaaaa acctgagttg gatgctactt tagtggctga aggtattgct       360
     cagcagttag agcaacgagt catgttcaga cgagctatga aacgtgctgt tacctctgct       420
     ctgaaagctg gagcaaaggg tattaaaatt tgtgtaagtg gccgattggg tggtgctgaa       480
     attgcaagaa gtgaatggta cagagaagga cgagtgcctt tacatacttt tagagctgat       540
     attgattatg gtaccgctga atccaagact acctacggaa ttattggcgt aaaagtgtgg       600
     atctttaagg gtgaaattct cccgcaaaag aaaagatcaa ctgaaagcgc ccagtga          657
//

If you have problems or comments...

PBIL Back to PBIL home page