(data stored in ACNUC7421 zone)

EMBL: CP000675.RPSD

CP000675.RPSD        Location/Qualifiers
FT   CDS_pept        448237..448857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="LPC_2991"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2991"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56892"
FT                   /db_xref="GOA:A5IHP2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP2"
FT                   /protein_id="ABQ56892.1"
FT                   /translation="MARYLGPKCKLSRREGCDLLLKSGVRDHKSKCKSEKLPGQHGDKK
FT                   PRLNSYGIQLREKQKIRRLYGILEKQFRNYYKKAARQKGSTGENLMALLERRLDNVVYR
FT                   MGFASTRAEARQLVAHKAILVNDKVVNVPSFLVNPGDTVSVRQKAKNQGRIQAALALSE
FT                   QRAPCDWITVDTGSFKGTFSTAPTLMDLSSDYNVNLVVELYSK"
     atggctagat atcttggtcc taaatgtaaa ttatcacgac gtgaaggttg tgatttatta        60
     cttaaaagtg gggttcgtga tcataaatcc aagtgtaaat ctgaaaagtt acctggacag       120
     catggtgata aaaaacctcg tttaaatagt tatggaattc agcttagaga gaaacaaaag       180
     attagaaggc tttatgggat tcttgaaaag caattccgta attattacaa aaaggcggct       240
     agacaaaagg gctctacagg tgaaaattta atggccctat tggaaagacg tttagataat       300
     gttgtttatc gtatgggttt tgccagtaca cgtgctgaag ctagacaact tgttgcacat       360
     aaggcaatac ttgtaaatga taaagtagtt aacgtacctt cttttctggt taatcctggg       420
     gatactgtat cagttcgaca aaaggctaaa aaccaaggac gtatccaagc tgctttagct       480
     ttatctgaac aaagagcacc ctgtgattgg attactgtag atactggttc ttttaaaggt       540
     acattttcta cagcaccaac gttaatggat ttatcttcag actacaacgt aaaccttgtt       600
     gtagaacttt actctaagta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page