(data stored in ACNUC7421 zone)

EMBL: CP000675.RPSJ

CP000675.RPSJ        Location/Qualifiers
FT   CDS_pept        436822..437139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="LPC_3014"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56915"
FT                   /db_xref="GOA:A5IHR5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR5"
FT                   /protein_id="ABQ56915.1"
FT                   /translation="MSSNQNIKIRLKSFDHRLIDLSTREIVDTAKRTGAQIRGPIPLPI
FT                   RKEKFTVLTSPHVNKDARDQYELRTHKRLVVIVHPTEKTVDALMKLDLAAGVDVQISLD
FT                   D"
     atgagcagca atcaaaatat taaaataaga ttaaaatcct ttgatcatcg gttgattgat        60
     ctatcaacac gagaaatcgt tgatactgcg aaaagaactg gcgcacaaat acgtggacca       120
     attcctttgc ctatcagaaa agaaaaattt actgtattga cctcaccgca tgtaaataaa       180
     gatgcaagag atcaatatga attacgtact cataaacgcc tggtcgttat tgttcatcca       240
     actgaaaaaa ctgtagatgc tttaatgaaa ttggatttgg ctgccggggt tgatgttcag       300
     ataagccttg atgactaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page