(data stored in ACNUC7421 zone)

EMBL: CP000675.RPSQ

CP000675.RPSQ        Location/Qualifiers
FT   CDS_pept        441488..441742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="LPC_3004"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56905"
FT                   /db_xref="GOA:A5IHQ5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ5"
FT                   /protein_id="ABQ56905.1"
FT                   /translation="MSTNSESNARTMIGKVVSDKMDKTIVVMIERTVKHPKYGKIMKRR
FT                   TKLHAHDENQVCRVGNTVKIRESRPLSKTKSWVLVEVIS"
     atgtctacta atagtgaatc aaatgccaga acaatgattg gaaaagtagt tagcgacaaa        60
     atggataaaa ctattgtagt tatgattgaa cgtactgtga aacatccaaa gtatgggaaa       120
     atcatgaagc gaagaactaa actacacgca catgatgaaa atcaagtttg ccgagttggt       180
     aataccgtaa aaatccgtga gtcacgacca ctctctaaaa cgaaaagctg ggtattagtc       240
     gaagtaattt cataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page