(data stored in ACNUC7421 zone)

EMBL: CP000675.RPSS

CP000675.RPSS        Location/Qualifiers
FT   CDS_pept        439580..439858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="LPC_3009"
FT                   /product="30S ribosomal subunit protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56910"
FT                   /db_xref="GOA:A5IHR0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR0"
FT                   /protein_id="ABQ56910.1"
FT                   /translation="MARSIRKGPFIDHHLISKVEAAIESKSKKPIKTWSRRSTIVPEMI
FT                   DLTIAVHNGKDHVPVFITDNMVGHKLGEFAMTRTFKGHSGDRKAKGK"
     gtggctcgtt caattagaaa aggtccattt attgaccatc atttgatcag caaggtagaa        60
     gctgcaatcg aatcaaaatc aaaaaagcca attaaaactt ggtctagacg ttctacaatc       120
     gttcctgaaa tgattgattt aacaattgct gtgcataacg gcaaagacca cgttcctgta       180
     tttattacag acaatatggt tggtcataaa ttaggtgagt ttgccatgac tcgtacattc       240
     aagggccact ctggggacag aaaggctaaa ggtaagtaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page