(data stored in ACNUC7421 zone)

EMBL: CP000675.SDBA

CP000675.SDBA        Location/Qualifiers
FT   CDS_pept        378239..380812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdbA"
FT                   /locus_tag="LPC_0352"
FT                   /product="SdbA protein, putative substrate of the Dot/Icm
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54347"
FT                   /protein_id="ABQ54347.1"
FT                   /translation="MDYSRGLVWTENNLVDDILAQVQRLISLGADPKNICLDGMCIGGA
FT                   VATIAAAKLHEKGMKVKLNNERSFTSLSSLVFGFIVPELQTANWWSPLTYGRFLLAGVV
FT                   YALLTPLIWLAGWPVDVTKAWNRIPAQDKMYSVVRDKDNGLYDGVIHDHFCSIASLVDS
FT                   QINSILYKLSTDQLLTEEEKQILCDDQLSHHFKPSQSVLKNPKYKGPHFISRQDLVAEL
FT                   GHREEYTNHDYFLDRLREKFQLDRTIRPVALAEDGEKDIDGIPPQLSNHKERPLIIASS
FT                   GGTGHISATHGIINDLQSKTDNVVITQHHAELYKNKPFSITSVLIRIGVWLTSLPVLED
FT                   ILKGVMRFIGYPVLPSSSIFWDQMSKIQQSETKKENGIETGRTRPYVDMLLDIYPEGYE
FT                   YTAFNNATHLTSSIEDIQTMISFKGHVEEDNRNIVYQNILQRLMHAAKQSTPYTRLIST
FT                   QALSLGAICDAVKYYNTVFLPVYNAERGTSYQPITIDQYMTDLPSLGCIHFMNNLEELT
FT                   SEQRQLMEIHAVNMSEPFKEAHFGKEQGFKAVHNIDPRNNPMIRNAFKDLSLTKYLDKT
FT                   QSFDLHFNVYKKEKQNALPVLNGKEKITIKPHAKIASIMIGSLAANASADYAQYLLNQG
FT                   YDHIFLFGGLNDSIAARIDQIINSYPDSRHDEIRKKIILLGNQSDVEMAPIMTRSNCVV
FT                   IRGGGLSVMEQMAMPIMDEKIVLLHHEDNEEGPLTSGLSWEDGNADKLIEYLSEKGAYA
FT                   KKTSPGLCSGHLNEAEKDFEKKYITQLKSKGTKEKVDLTIPQQKKPPLKKEWGRKTGYT
FT                   ELGHVLSHQHRFFETIPEVREPFCSKEDLHHHELSSQSLVSVTVG"
     gtggattaca gtcgcggtct tgtctggaca gaaaataatc ttgtcgacga tattctggct        60
     caggtgcaaa ggctaattag ccttggtgcc gaccctaaga acatctgcct tgatggtatg       120
     tgtataggtg gggcggtagc aacaattgcc gcagcaaaac ttcatgagaa gggcatgaaa       180
     gtcaagttga ataatgaacg ctcttttact tctctttctt ctctagtatt tggttttatt       240
     gtacctgaat tgcaaacagc aaattggtgg agccctttga cttatggtcg cttcctactg       300
     gctggtgtag tttatgcttt actcacgcct ttaatttggc tggcaggctg gccagttgat       360
     gtgaccaaag cctggaatag aatacctgct caggataaaa tgtattctgt tgtgcgggat       420
     aaagacaatg gcttgtacga tggagtaatt cacgatcact tctgttccat tgcgtcgttg       480
     gttgattctc aaattaattc tattttatac aaattatcca ctgatcagct gcttactgag       540
     gaagaaaaac aaattttgtg tgatgatcag ctttctcacc attttaaacc aagtcaaagt       600
     gttttaaaaa atccaaaata caaaggcccg cattttattt cccgacaaga tttggtagct       660
     gagcttggtc atcgagagga atataccaat catgattatt tccttgaccg cttgcgggaa       720
     aaatttcaat tggatcgtac aatacggcca gtggctttgg ctgaagatgg ggaaaaggat       780
     atagatggga ttccaccgca actatctaat cataaagagc gtcccttaat tattgccagc       840
     agtggaggaa cagggcatat ctctgccact catggcatca ttaatgattt acagagtaaa       900
     acagataatg ttgtcattac gcagcatcat gcggagctct acaaaaacaa gcccttctca       960
     attacatctg ttctgattcg tattggtgtt tggttgacct cccttcctgt cctggaggac      1020
     atactgaaag gagttatgag gtttatcgga tatcccgttt taccgagctc ctccatcttt      1080
     tgggatcaaa tgtctaaaat acagcaaagt gaaactaaaa aagaaaatgg aattgaaaca      1140
     ggcagaaccc gtccttatgt ggacatgttg ttggatatat acccagaggg atatgaatac      1200
     acagcattca ataacgcgac tcacttgact tccagtattg aagacattca aacgatgata      1260
     agcttcaagg ggcatgttga agaggataac aggaatatag tctatcaaaa tatattacaa      1320
     cgccttatgc atgcggcgaa acagagtact ccttacacaa gattaatttc cacacaggcg      1380
     ctttctttgg gagctatttg cgatgccgtt aaatactaca atacggtatt tttgcctgta      1440
     tacaatgctg aaagaggaac ctcctatcag cctattacca ttgatcagta tatgaccgat      1500
     ttgccttcac tgggttgtat tcattttatg aataatttgg aggagctcac atcagagcaa      1560
     aggcaattga tggagataca tgcagtaaat atgagtgaac catttaaaga ggcgcatttt      1620
     ggtaaagaac aaggctttaa agcggttcat aacattgacc cacgtaataa cccaatgatt      1680
     cgcaatgcct ttaaagatct ttcattgaca aaatacctgg ataagacaca gtcatttgat      1740
     ttgcacttta atgtttataa aaaggaaaaa caaaatgcac tgccagtact gaatggtaaa      1800
     gaaaaaatta caatcaaacc gcatgctaaa attgcttcca tcatgatagg ctctctggcg      1860
     gcaaatgctt cagctgatta tgcgcagtat ttattgaatc aggggtatga tcatattttt      1920
     cttttcggcg ggcttaatga ttccattgcc gcacgcatcg atcagatcat caattcttac      1980
     cctgactcca ggcatgatga gatacgtaag aaaattattc tcctggggaa tcaatctgat      2040
     gttgaaatgg caccgataat gaccagaagt aactgtgtgg ttatccgtgg gggtggttta      2100
     agtgtcatgg agcaaatggc tatgcccatt atggatgaga aaattgtatt actacatcat      2160
     gaagataatg aagaggggcc tttaacgtct ggtctcagtt gggaggatgg gaatgccgat      2220
     aaattaatcg agtatctatc cgaaaaaggg gcatatgcta aaaaaacatc acctggcttg      2280
     tgttctggcc atctcaatga ggcagaaaag gattttgaaa agaaatatat tacccaacta      2340
     aaatcgaagg gaaccaagga aaaagtagat ttaaccattc ctcagcaaaa gaagcctccc      2400
     ctgaaaaaag agtggggtag aaaaacaggt tatactgaac tcgggcacgt attatcccat      2460
     caacataggt tttttgaaac gattcctgaa gtaagagagc cattctgttc taaggaagat      2520
     ttacatcatc atgagctttc cagtcaaagt ttggttagtg taacagttgg ttga            2574
//

If you have problems or comments...

PBIL Back to PBIL home page