(data stored in ACNUC7421 zone)

EMBL: CP000675.SDHA

CP000675.SDHA        Location/Qualifiers
FT   CDS_pept        complement(468751..473040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="LPC_2967"
FT                   /product="SdhA, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2967"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56868"
FT                   /protein_id="ABQ56868.1"
FT                   /translation="MISEKIKLLESFKQNQFSKLIEKINSKILATLKSGHFNPRLAPYL
FT                   EKMNKDGVPFTDFDLDPENISQIKKLINALYHARLAFLDLENIDIGNIKRTIPDLKLLY
FT                   SNTIHQAYQAGYLITNLDVDLQEMFKEEIDLILPVIGKLQAFAGEHQECTKHLAESLKD
FT                   FPISYKAGEVTGIALEQMQPRTGDWDYQFLTQFSAVLPGYIEKLTQYIQQYSSQIKEKE
FT                   PTLNNEKLEELQNASLKLLNDLEHLKGNDFFISLKVLKYIHIIRNIITLATSSVEQMGH
FT                   FSDSSQDVIRDNLAQLKYVVLPTLFGLVDKIEDNAMLKPGTLSIPLMEKIKPLYQLLIY
FT                   YASKPVNFKEKGEELLSIEDSRFLALRLERTYQRIDEANKALFKIQKAQEALDNFYKIL
FT                   DTPPYNKQPIHQLPKEIKNQLITYYKIISPYMMDVNPDLNILLIDSFQGPESWSSYLKK
FT                   PWRWLRGTLPADHASFVLAQKEALQTLISKKKATQQFHIELNRDLIESVHKQTNLVLFP
FT                   YSEKTNVFLLDETKALNPANGATDKLKFRPEKGHNILVNPEDLTSEQALDLYQWYRNKR
FT                   EKFRVASKAYNEFITLLKKQTKTIAETEGRILHLNNLDKETKTRCRNLYNIFQPYFIDG
FT                   IPPELRASAISFDKFLVHSFSNESSTYDAPAVDLFEKLDEHFQIYFTEIDLQWGKKSNQ
FT                   YLKWAQEKFASENNSTELEHDEKLESRAHHLIKHTNFSKCIHEFRTELNQVISFFNNAM
FT                   RAQLKQQPNGIPYPELQDQNKELAQSEQVVAIKRIFNSLYHVEKIVVELEKLDTRSYES
FT                   IYVYHLIQAYDHINEIKKLALKLAVDPHFKLIASELLEKAQTLIATIQEHSDAYQVSPL
FT                   EVPYNQDIKYNALWYTLNAFYISPKHIRSLRNTNYLTTEELNDLHLKAKKATVTVENII
FT                   KSSNSYFKLFLQTPAMYSLYREMTNKLNEFISTSHDAVMNNLDQFRSKIFTPMLMEADA
FT                   WEDKLGLVPGTISGPLKTITDEYYKGLLHPLALHSKAHIRMICDKTPIDQRIKTTNKKL
FT                   ENATQHLDKIEKNYKHIIKLYEIIKTKGGKTTDDELIETYKKALYKLVKLQKRLPQNTD
FT                   HDPKDYELDTLLNSELKEYEPKLTLIKPLIISSYHHYEGLKATYLMKANTAREKLSYLK
FT                   ELRSTQEQEDLLYIEEYTTESFNKQLDAFCNRHIGLQYTDKEYRTKLREYLLTFKESII
FT                   QRSKSAEDINLTIKNLLKEKIKNFERDNFEKYYHLDAVRVALAQFKNYFSLSTAAIEQN
FT                   NSTFESEETLAKKTELINKLVDISEDGTLTPKERVDQISFHVKNPNFERIIMDYKQESY
FT                   FSFTYLKQCILSLLEALCLYTPERRKLFNNLESSVKTQPKINELTKRFGLFAGNESAIS
FT                   TESRAITPVSSVENNGTIELNQLAPST"
     atgatttcag aaaagatcaa gcttttagaa tcctttaagc aaaaccaatt ctctaaatta        60
     attgaaaaaa ttaattcaaa aatccttgcg actttaaaaa gcggacattt caaccccaga       120
     ctagccccct acttggaaaa aatgaataaa gacggggttc cattcaccga ttttgatctt       180
     gacccggaaa atatttctca aatcaagaaa ctcattaacg ccctttacca tgcccgttta       240
     gcttttctgg atttagagaa tattgacata gggaacatca aacgaactat ccctgatctc       300
     aaattacttt acagcaacac gattcaccag gcctatcaag ccggttatct aatcactaac       360
     ctggatgttg atttgcagga aatgttcaag gaagagattg atcttattct tcctgtcatt       420
     ggaaaattac aagcttttgc tggtgaacac caggaatgca ccaagcattt ggcagaatct       480
     ttgaaggatt ttcctataag ctataaagca ggagaagtta caggcattgc cttagagcaa       540
     atgcaaccga gaacaggaga ttgggattac caattcctca ctcaattcag tgccgtatta       600
     cctggttata tagaaaaatt aactcaatac attcaacaat actcttcgca aatcaaagaa       660
     aaagagccta ctctaaataa tgaaaagctg gaagagttac aaaacgcatc attaaaatta       720
     ctaaatgacc tggaacatct gaaagggaat gactttttta tatcccttaa agttttaaaa       780
     tacattcaca ttatccgtaa tatcatcaca ttggcgacaa gctctgttga acaaatggga       840
     catttcagcg attcatctca ggatgtcatt cgtgataatt tggctcaatt aaaatacgtt       900
     gtattaccta ctttatttgg gttagtggat aaaattgaag acaatgccat gctgaagcct       960
     ggtacactgt ctattccgtt aatggaaaaa atcaaacctc tataccagct tttaatttat      1020
     tacgcatcca aacccgtcaa tttcaaagaa aaaggagaag agttactcag tatagaggac      1080
     tcccgttttc tcgctttaag actggaaaga acatatcaac gaattgatga agctaacaaa      1140
     gcccttttta aaattcaaaa agcgcaagaa gctctggata atttttacaa aatattggac      1200
     acccccccct ataataagca acccatacat caattaccga aagaaattaa aaaccaactg      1260
     attacatatt acaaaataat cagtccttat atgatggatg tgaatcctga tctcaatatt      1320
     ttgttgatcg atagttttca gggcccggaa tcctggtctt cttatttaaa gaagccgtgg      1380
     cgttggttaa gaggcactct tccagccgat cacgccagtt ttgttttagc gcaaaaggaa      1440
     gcattacaaa ctttaattag caaaaagaaa gccactcaac aatttcatat cgaattgaat      1500
     agagacctta tcgaatctgt tcacaaacaa acaaatctgg ttttattccc ttatagtgaa      1560
     aaaacgaatg tctttcttct agatgagaca aaagcactaa accctgctaa tggcgctacg      1620
     gacaaactaa aattcaggcc agagaaggga cataatatac tggttaatcc tgaagattta      1680
     acatctgaac aggctcttga cctctatcaa tggtatagaa acaaacgtga gaaattcaga      1740
     gttgccagca aagcatataa tgaatttatt accttattaa aaaagcaaac caagacaatc      1800
     gctgaaacgg aaggcaggat tctccattta aataatcttg ataaagagac caaaactcgc      1860
     tgccgtaatt tatataatat atttcaacct tattttatcg atgggatacc tcctgaactc      1920
     agagcttccg caataagttt tgacaaattt ttggttcatt ccttttctaa tgagtcatcc      1980
     acctatgatg ccccggcagt tgacctgttt gaaaaactgg atgaacattt tcaaatttat      2040
     tttacagaaa ttgatttaca atggggtaaa aagagtaatc aatatttaaa atgggcccag      2100
     gaaaaatttg ccagtgaaaa taactcaacc gaacttgaac atgatgaaaa actggaaagc      2160
     agagcccatc atttaattaa acataccaat ttctctaaat gcatacatga gttcagaacg      2220
     gagcttaatc aagtcatttc gttttttaat aatgcgatga gggcgcaatt aaaacaacaa      2280
     cccaatggaa taccttaccc tgaattgcaa gatcaaaata aagagcttgc ccagagtgaa      2340
     caggttgttg cgataaaacg catattcaat agcctctatc atgttgaaaa gattgttgtt      2400
     gaactggaaa aactggacac cagaagttac gaaagcattt atgtctatca tttaatacaa      2460
     gcctatgatc acattaatga aattaagaaa ttagcgctaa aactcgctgt ggatcctcat      2520
     tttaagctca tagcaagcga gttactggaa aaagcgcaaa ctcttattgc aacaatacaa      2580
     gaacacagtg atgcgtatca ggtatccccg ttagaagtac cttataacca ggatattaaa      2640
     tacaatgctc tctggtatac actcaatgct ttttatattt caccaaaaca cattagaagt      2700
     ttaagaaata ccaactatct cacgacagaa gaactcaacg acttacactt aaaggcaaaa      2760
     aaagcaaccg ttactgtaga aaatatcatt aaaagttcaa actcctattt caaattattc      2820
     ttacaaacgc ctgccatgta ttctctctat agagaaatga cgaacaaact gaatgaattt      2880
     attagcacat cacatgacgc cgtaatgaat aatctggatc aattccgctc caagattttt      2940
     acacccatgc tgatggaagc ggacgcatgg gaagataaat taggcttggt accaggtact      3000
     atctcaggac cattaaaaac aataacggat gaatattata aaggcctgtt acatccttta      3060
     gcgctgcatt ccaaagcaca tattcgaatg atatgtgata aaacaccaat agatcaaaga      3120
     ataaaaacaa cgaataaaaa actcgaaaat gcaacacaac atttggataa aatagaaaaa      3180
     aattataaac atatcatcaa gctatatgaa attatcaaaa caaaaggcgg caaaaccact      3240
     gatgatgaat taatcgaaac ttataaaaaa gctctgtaca aattggtaaa attacaaaag      3300
     cgattacccc agaatacaga tcatgatcct aaagattatg aattagacac tcttttaaat      3360
     tcagagctga aagagtatga acctaaatta acgctcatta agcctctcat tatctcaagc      3420
     taccatcatt atgaaggcct aaaagccact tatcttatga aagcaaatac tgccagagaa      3480
     aagttgagtt atcttaaaga gttacgatcg actcaggaac aagaagatct cctttatata      3540
     gaagaataca ctacagaatc atttaataaa caattagatg ctttctgcaa ccgtcatatc      3600
     ggtttacaat acactgacaa ggaatatcgc acaaaactta gagaatattt actgacattc      3660
     aaagaaagta ttattcaacg ctcaaaatcc gcagaagata ttaatttaac tataaaaaat      3720
     ttgctaaagg aaaaaattaa aaattttgaa agagataatt ttgaaaaata ttatcatctt      3780
     gatgcagtaa gagttgcttt agctcaattt aaaaactact ttagtctttc taccgctgcc      3840
     atcgagcaaa ataattcgac atttgaaagc gaagagacac tggcgaaaaa gacagagctc      3900
     attaataaac tggttgatat cagtgaagat ggaaccctta cgccaaaaga gcgtgtcgac      3960
     caaatatctt tccatgttaa aaatcctaat tttgaaagaa tcatcatgga ttacaaacag      4020
     gaaagctact ttagctttac ctatttaaaa caatgcatct tatccttatt ggaagcgctt      4080
     tgcctgtaca ctccggagag aagaaaacta tttaataatt tggaaagctc tgtaaaaacc      4140
     cagcctaaaa tcaatgaact gaccaaacga tttggattat ttgctggcaa tgagtcagct      4200
     atctctactg aatccagggc aattacccca gtttcttctg ttgaaaataa tggaacaatt      4260
     gaattaaacc aattagcgcc atcaacataa                                       4290
//

If you have problems or comments...

PBIL Back to PBIL home page