(data stored in ACNUC7421 zone)

EMBL: CP000675.SDHB

CP000675.SDHB        Location/Qualifiers
FT   CDS_pept        complement(166083..171680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="LPC_0156"
FT                   /product="SdhB protein, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54155"
FT                   /protein_id="ABQ54155.1"
FT                   /translation="MPDKKSSETLLSQQINEVRGLLLQALKTQLDDLVAEKLIPQPSGV
FT                   PFVDFEKDPPQIATLKKVINCLYHAEEAFKSWESIDTSTLLGKAKAAPKLIHALTQIYK
FT                   SLGLLDEASPEIRSVIADNYHLLEPLFTQAYAIVQESGWLSEFMEMDVTDKASKVIFQG
FT                   MDLLGPDVDKWHDTHPLVDAFSKISKLVETISTLQEKDMPGKEKEQAVELIRALLDDLD
FT                   NNPFISKLSISDFEDSKAIKDLLEWFKNIQDDGFDFSKKSIKQYVSWANHYLPTLIAFA
FT                   DQLERQNYLKPGSLSANLCSQIEHLGKQVNDILSEPGFGVTERVVTIDSLQGQREQKIH
FT                   NAQVKSVQVIMATEKQLAATADFYQILEAYKGMNLSQITEPDRRVLRQLYPQIQTALAH
FT                   ASLDLENQLTSVLNTTGPEKTPAKPKSWWELAKDGLGYVASYVVNYNVDKILGTRESVD
FT                   RFLSSQIASEQFKILIAEKAREKLRTGSDKIKETALQYQAEARLNAIKSTLRKQPSQME
FT                   APPSEFVAVKPSKLVNLRGTLTAIQEMQLSTTVNGTRTSVDTLIHRHLPEKYQACFSTL
FT                   PYQINENDPELVKKIKTVENNLFQLEKALKDFEKIDLSYGIMIRLHYFIAIASAASKLK
FT                   SSVKELPPEGQKALAPLLQQIMTLGLSFSDTNYTANDLSALQQLKMEGEVRPKSPSVAS
FT                   PDTIGTLPEETGKRTVKKPKEKTTELLDYADKISNARASLLNKFKNTLSPALADSLNPQ
FT                   KNGVPFVHLDQDPPQIAAIKKIINSMYHAECALKTWHGIDTSTTLGKVAAAHQGVAALS
FT                   QVYKSFTLFTEDFSDIHNLIRENHDLIAPVIIEANKLVNQYGWARQFSELDIAQQLGSI
FT                   LGQGINTVQPKTDEITQTASLVKLFSEIPRLLNNISSSLDQKSEKSIDELKISNKKIEA
FT                   IGAVFELFFEENAHLMSMFKGFSAISGLIELNKKIQLEGTNLQEVTIRQYQSWLKEGYP
FT                   NLMMILDEIETRHYLTPGFLSAPIALELDQINDKLNEIIETKPDFKLQKIPLSFYMGDK
FT                   RIERLMTKKTEHCLAVLQIEEQKKAVNTFFGILKHYSDQPLSNIKPNELAQLRLAFVEI
FT                   QSAMANSNLELSNDFVAALNQLETSPPEKTKKIQVTVSQLLKVQPAVETYLNEHKKSSE
FT                   LKIAVIDKAIEHVKDKSFELKSGASKEINIPQLRKTFLETESKKPVVGPGELKPTSVSS
FT                   LNTVRGNLAYIQELKISSTVGMMREQFSALTRDNFSNRVQKYLIKPQDKPLHMINDNDP
FT                   LMVRQIKEVENGLYHLETALKQFEQMKKSDSLVSQTKALLEIANHALQLKMAVERFSPE
FT                   LKEHYGPLVRTVLSFSNKIQSINYNKEDWADLQFILNRAHKELLKRKTPRDHRIEKAFF
FT                   EAGVREVQIDRDESVGKKAAKLGVKYAHLASPQLEKARAYLSSRYKNAFGQQPKVIRSF
FT                   TREQLANEEFMDAEISRLKETLEEKYGFNIATIKVLLDLLEQIQRAGAQAAEVAGMVNT
FT                   LVTYDFPKIKENAYRDLLTKLSQEEDYLNLKPGTLINPAMAAVNQLFLSAALELDMPFS
FT                   KKLSILDDTTYVNILIRQTESDLQTLKEKLSEDPSNHEIAFEIEIKNDKLAFLRQQMVL
FT                   LEDKNPNQTRNVLMDMQFEVSLRNHLVYTTLKAPIAQEYEQIAIEYYKKNKNRFLYADD
FT                   CSKELLQGLKEFEKKHLPDHLIVFEAYDRLRLFSAKLPPKNQDVKEYIENINRELQNRD
FT                   IPIRQRALKVKLLPNDTVFIEKLISADKGTHFLRKFMQFITIITASITEAIKTGGSLVY
FT                   IYRQKQMEQSIKNIEKSISFKEELHTIKDPDGPSPRKEEGQEGEIEFTKL"
     atgccggata aaaaatcatc agaaactctg ttatcgcagc aaataaatga agtaagaggt        60
     ttgctgctgc aagcccttaa aactcaatta gatgatctgg tagctgaaaa actcattcca       120
     caaccaagtg gcgttccttt tgttgatttt gagaaagatc caccacaaat tgcgactcta       180
     aaaaaagtaa ttaattgtct ttatcatgca gaggaagcgt ttaaaagctg ggaaagcatt       240
     gacaccagta cgctattggg taaagccaaa gcagcaccaa aattaattca cgcgctaacc       300
     cagatataca aatccttggg cttacttgat gaggcaagcc ctgaaataag aagtgtcata       360
     gcagacaatt accatttact tgaacctcta tttactcaag cgtatgccat cgtgcaagag       420
     tctggctggt tatcagaatt catggaaatg gatgtgaccg ataaagcatc caaagtgatc       480
     ttccaaggga tggatttatt aggtcccgat gtcgataaat ggcatgatac gcatcctctt       540
     gttgacgcat tttcaaaaat atcaaaactg gtagaaacca tatccacact acaagaaaag       600
     gacatgccgg gaaaagagaa agaacaagcg gtagaattga ttcgcgcctt acttgatgac       660
     ctggacaata acccttttat cagcaaatta agtatcagtg attttgaaga ctccaaagcc       720
     ataaaggatt tattggaatg gtttaagaac atacaagacg atggttttga ttttagcaag       780
     aaatccatta agcaatatgt ttcctgggca aatcactatt tacccacatt aatcgccttc       840
     gctgatcaac tggaacggca aaactattta aaaccaggca gcttatccgc caatttgtgt       900
     tctcagatag aacatttggg taaacaagtg aatgacattt tatctgaacc tggttttggt       960
     gttactgagc gagttgtaac aatagactca ttgcagggac aaagagagca aaaaattcat      1020
     aacgctcagg tcaaaagtgt gcaagttatc atggctactg aaaaacaact agcggccact      1080
     gctgattttt atcagatcct ggaagcctat aagggcatga atctttcaca aataacagaa      1140
     ccggatcgga gagtgctaag acaattatat ccccaaatac aaacagcgct ggcgcatgcc      1200
     agtttggatc ttgaaaatca gttaacctct gttttaaaca ctaccggccc tgaaaaaacc      1260
     ccagctaaac ctaaatcatg gtgggaatta gccaaagatg gtttaggtta tgtagccagt      1320
     tatgtggtca attacaacgt tgataaaatc ctgggaacca gggaatctgt tgatcgtttt      1380
     ctgtcaagcc aaattgcgtc cgagcaattt aagatcctga ttgctgaaaa agcccgtgaa      1440
     aaattaagaa ccggatcaga taaaataaaa gaaactgcac tgcaatatca agcggaagct      1500
     cgtctcaatg ctataaaatc aaccctgaga aaacaaccct ctcagatgga ggctccccca      1560
     tccgaatttg ttgcagtgaa accatcgaaa ctggtcaatc ttcgtggaac acttacagcc      1620
     attcaggaaa tgcaattatc gactacagta aatggcacaa gaacaagtgt cgatactctg      1680
     attcatcgcc atttgccaga aaaatatcaa gcctgttttt caactcttcc ctatcaaatc      1740
     aatgaaaatg atcctgagtt ggttaaaaaa attaaaaccg ttgaaaataa tttgtttcaa      1800
     ttagaaaaag cgcttaaaga ttttgaaaaa atagacttga gctatgggat tatgattcga      1860
     ttgcattatt ttatcgcaat agcttctgca gcctccaaac taaaatcaag tgttaaagaa      1920
     cttccccctg agggtcaaaa agcgctagcc cctctattac aacaaattat gacattaggc      1980
     ttatccttct cagacaccaa ttatacagct aatgatttgt ccgccttgca acaattaaaa      2040
     atggaaggcg aggtgagacc caaaagtcca tccgtagcat ctccagatac aataggaacg      2100
     ttacctgaag aaactggaaa gagaactgta aaaaaaccaa aagaaaaaac gactgaatta      2160
     ttggattatg ctgacaaaat cagtaatgct cgagcatcgc tattaaataa gtttaaaaac      2220
     accctgtctc cggcactagc cgacagttta aatccacaaa aaaatggcgt tccatttgtt      2280
     catcttgatc aagacccgcc acaaatcgcg gcaataaaaa aaatcatcaa cagtatgtat      2340
     catgcggagt gcgctcttaa gacctggcat ggcatagata ccagcactac attaggcaag      2400
     gttgctgcag cacatcaagg cgtagcggca ttatctcaag tgtacaaatc atttacattg      2460
     ttcaccgagg atttctcaga cattcacaat ttaattcgtg agaaccacga tttaatagcg      2520
     cctgtgatta tcgaagcaaa caagctggtt aatcagtatg gatgggcacg tcaattcagt      2580
     gagcttgata tagcgcaaca actgggaagc attttaggtc agggaattaa tacagttcaa      2640
     cctaaaacgg atgaaataac gcaaaccgct tctctggtta aattattttc agaaattcca      2700
     aggttattga acaatatttc aagttcattg gatcaaaaat ctgagaaatc aattgatgag      2760
     ttaaaaatca gcaacaaaaa aattgaagcc ataggcgcag tatttgaatt gttttttgaa      2820
     gaaaatgccc acttaatgag catgttcaaa ggattcagcg ctatctctgg tcttatcgaa      2880
     ttaaataaaa aaattcaact tgaaggaacc aacctgcagg aagtcactat tcgacaatac      2940
     cagtcatggt taaaagaagg ttatcccaat ttgatgatga ttcttgatga aattgagact      3000
     cgtcactact taacccctgg ctttttatca gcacctattg ccctggaatt agaccaaatt      3060
     aacgacaagc ttaatgaaat tattgaaacc aaacctgatt ttaaattaca aaaaattcct      3120
     ctttcattct atatgggaga taaacgcata gagcgcttaa tgactaaaaa aacggaacac      3180
     tgcctcgcag tgttgcaaat agaagagcaa aaaaaagcag tgaacacttt tttcgggata      3240
     cttaaacact attcagatca accgctgtca aacataaagc caaatgagct cgctcaattg      3300
     cgtcttgctt ttgtagagat tcaatccgca atggcaaata gtaatttgga attaagcaat      3360
     gatttcgttg ctgctttaaa ccaacttgaa acctccccac ctgaaaaaac aaaaaaaatc      3420
     caggtgacag tctctcaatt gttaaaggtg cagcctgcag ttgaaaccta tttaaacgag      3480
     cacaaaaaat cctctgaatt aaaaatagca gtcattgaca aagccatcga gcacgttaaa      3540
     gacaaatcgt ttgagctgaa atctggtgca tcaaaagaaa tcaatatccc tcagctgcgc      3600
     aaaacatttt tagaaactga aagcaagaag cctgttgtag gtcctgggga attaaaacca      3660
     acatcagtct catctcttaa caccgttcgt ggtaatttgg cttacatcca agaattaaaa      3720
     atctcatcca ccgtaggcat gatgcgagaa cagttttctg ctcttaccag agataatttc      3780
     tccaatcgag tgcaaaaata tttaatcaaa cctcaagaca agccattgca tatgataaat      3840
     gacaacgatc cgctcatggt aaggcaaatt aaagaagtcg aaaacggttt atatcacttg      3900
     gaaaccgctt taaaacaatt tgaacaaatg aaaaagagcg acagcctggt atcacaaacc      3960
     aaagcactgc tagaaatagc aaatcatgct ctccaattaa aaatggcggt ggaacgattt      4020
     tctcctgagt taaaagagca ttatggtcca ttagttcgga ctgtattgag tttcagtaat      4080
     aagattcaat cgatcaatta caacaaagaa gattgggccg atcttcagtt tattcttaat      4140
     agggcccata aagaattgtt aaaaagaaaa actccaagag accatcgtat tgaaaaagca      4200
     ttttttgaag ctggagttcg tgaagtacaa atcgatcgtg atgaatcggt aggaaaaaaa      4260
     gctgcaaaac tgggggtaaa atacgcgcac ctggcctccc ctcagttaga gaaagcaaga      4320
     gcctatttaa gttccagata caaaaatgcg tttggtcaac aacccaaggt tattcgttcg      4380
     tttacccgag aacaattagc gaatgaagaa tttatggacg ctgaaattag cagattgaaa      4440
     gaaacattag aagagaagta tggttttaat attgcaacga tcaaagttct tcttgattta      4500
     ttagaacaaa ttcaacgggc tggggctcag gcagctgagg tagctggcat ggtcaatacc      4560
     ttggttactt atgacttccc caagataaaa gaaaatgcgt atagagattt acttacgaaa      4620
     ttatctcagg aagaagacta cctgaactta aaaccaggca cattaattaa tccagccatg      4680
     gctgcagtca accaattatt cttatctgct gccctggaat tagacatgcc ttttagtaaa      4740
     aagttatcta ttctggacga taccacttat gtcaatattc tcatcagaca aaccgaaagc      4800
     gatctgcaaa cattaaagga aaagctatcc gaagatccct cgaatcatga aatagcattt      4860
     gaaattgaga ttaagaacga taaattagct ttcctcaggc aacagatggt gttgcttgaa      4920
     gataaaaacc ccaatcaaac cagaaatgtc ttaatggaca tgcagttcga agtgtcatta      4980
     cgtaatcacc ttgtttatac aacgcttaaa gcgccgattg cccaggaata tgaacaaatt      5040
     gccatagaat attacaaaaa aaacaaaaat cgctttctat atgccgatga ctgttcaaaa      5100
     gagttgctgc aaggattgaa agaatttgaa aaaaaacatt tgcctgatca tttgatagtt      5160
     tttgaagcct acgacaggct ccgcctattc agtgcaaaac tcccccccaa aaatcaggat      5220
     gtcaaagagt atattgagaa catcaataga gaattacaaa atagagacat cccaataagg      5280
     caacgtgctt taaaagttaa attattaccc aatgacactg tctttattga aaaattaatt      5340
     tcagctgata aaggcactca tttcctgaga aaattcatgc agtttattac aatcattaca      5400
     gcaagcatca ccgaagcaat aaaaaccggg ggcagtttgg tttatattta tcgccaaaaa      5460
     caaatggaac aatcaataaa gaatatagaa aaatcaataa gctttaaaga agagctccat      5520
     accataaaag atcctgatgg cccttcacca cgcaaggaag aaggacaaga aggtgaaatc      5580
     gaatttacca aattgtaa                                                    5598
//

If you have problems or comments...

PBIL Back to PBIL home page